Appendix B. Release Notes
Table of Contents
- Release 26.11 (“Zokor”, 2026.11/??)
- Release 26.05 (“Yarara”, 2026.05/30)
- Release 25.11 (“Xantusia”, 2025.11/30)
- Release 25.05 (“Warbler”, 2025.05/23)
- Release 24.11 (“Vicuña”, 2024.11/28)
- Release 24.05 (“Uakari”, 2024.05/31)
- Release 23.11 (“Tapir”, 2023.11/29)
- Release 23.05 (“Stoat”, 2023.05/31)
- Release 22.11 (“Raccoon”, 2022.11/30)
- Release 22.05 (“Quokka”, 2022.05/30)
- Release 21.11 (“Porcupine”, 2021/11/30)
- Release 21.05 (“Okapi”, 2021.05/31)
- Release 20.09 (“Nightingale”, 2020.10/27)
- Release 20.03 (“Markhor”, 2020.04/20)
- Release 19.09 (“Loris”, 2019/10/09)
- Release 19.03 (“Koi”, 2019/04/11)
- Release 18.09 (“Jellyfish”, 2018/10/05)
- Release 18.03 (“Impala”, 2018/04/04)
- Release 17.09 (“Hummingbird”, 2017/09/??)
- Release 17.03 (“Gorilla”, 2017/03/31)
- Release 16.09 (“Flounder”, 2016/09/30)
- Release 16.03 (“Emu”, 2016/03/31)
- Release 15.09 (“Dingo”, 2015/09/30)
- Release 14.12 (“Caterpillar”, 2014/12/30)
- Release 14.04 (“Baboon”, 2014/04/30)
- Release 13.10 (“Aardvark”, 2013/10/31)
This section lists the release notes for each stable version of NixOS and current unstable revision.
Release 26.11 (“Zokor”, 2026.11/??)
Highlights
Create the first release note entry in this section!
New Modules
tranquil is an ATProto PDS (personal data server) implementation in Rust. A featureful, spec conscious and community driven alternative to the Bluesky reference implementation PDS. Available as services.tranquil-pds.
scx_loader, a system daemon and DBus-based loader for sched_ext schedulers.
scxctlis the command-line client for interacting with the loader, allowing users to switch schedulers, modes, and arguments dynamically. Available as services.scx-loaderNezha, a self-hosted, lightweight server and website monitoring and O&M tool. Available as services.nezha.
mail-tlsa-check-exporter, validates SMTP / IMAP server certificates against a TLSA record as a Prometheus exporter. Available as services.prometheus.exporters.mail-tlsa-check.
CastSponsorSkip, skips YouTube sponsorships (and sometimes ads) on all local Google Cast devices.
Stump, a free and open source comics, manga and digital book server with OPDS support. Available as services.stump.
Freescout, a free, open source Helpdesk and shared mailbox. Available as services.freescout.
Koito, a modern, themeable scrobbler that you can use with any program that scrobbles to a custom ListenBrainz URL. Available as services.koito.
FlapAlerted, detects BGP flapping events and provides statistics based on BGP update messages. Available as services.flap-alerted.
gocron, a task scheduler with web interface. Available as services.gocron.
Unpackerr, extracts downloads for Radarr, Sonarr, Lidarr, Readarr, and/or a Watch folder. Available as services.unpackerr.
Matrix Authentication Service is an OAuth2.0 and OpenID Connect provider for Matrix homeservers (such as Synapse). It replaces standard password authentication with modern OpenID Connect flows, and can delegate authentication to upstream OIDC providers. Available as services.matrix-authentication-service.
Backward Incompatibilities
boot.vesahas been removed. It was deprecated in 2020 because Xorg now works better with kernel modesetting. If you still need the legacy VESA 800x600 fallback, setboot.kernelParams = [ "vga=0x317" "nomodeset" ];directly.authentikhas been updated to 2026.5.3, which changes the default listen address from0.0.0.0to[::]. IPv4-only deployments might need to adjust their listen settings. Deployments running the server and worker in the same network namespace must also set at least the workerAUTHENTIK_LISTEN__HTTPaddress so that the server and worker do not bind to the same address.Support for the legacy U‐Boot image format has been removed from the initrd generators, as it is deprecated upstream and no longer used by any platform in Nixpkgs.
Rustical migrates from
settings.http.hostandsettings.http.porttosettings.http.bindto support UNIX domain sockets as well as TCP sockets in one setting.A number of options for
services.llama-cpphave been removed in favor of the structuredservices.llama-cpp.settingsoption, attributes from which are used as arguments tollama-serverexecutable, you can see all available options by runningllama-server --help. Configuring model presets using Nix attribute set viaservices.llama-cpp.modelsPresetis no longer supported, please useservices.llama-cpp.settings.models-presetwith a path to an INI file containing desired options.Python 2 has been removed from the top-level package set, as it is long past end-of-life. The
python2,python27,python2Full,python27Full,python2Packages, andpython27Packagesattributes, along with the legacypython,pythonFull, andpythonPackagesaliases, now throw an error directing you topython3. TheisPy2andisPy27package flags have been removed accordingly. The only remaining Python 2 interpreter is vendored inside theresholvepackage for itsoildependency and is not exposed for general use.security.polkit.enablePkexecWrapperhas been introduced, making thepkexecsetuid wrapper opt-in.When Avahi’s mDNS resolver is enabled (
services.avahi.nssmdns4orservices.avahi.nssmdns6), only the minimal mDNS resolver is enabled by default to avoid adding a 5 second delay to every failed reverse hostname lookup (e.g., delaying ping by 5 seconds). The “full” mDNS resolver now remains disabled unlessservices.avahi.nssmdnsFullis also enabled. Users who have customized/etc/mdns.allowto allow mDNS domains not ending.localmust enableservices.avahi.nssmdnsFullto continue to resolve such domains.systemd.user.extraConfighas been removed in favor of the structuredsystemd.user.settings.Manageroption. Usesystemd.user.settings.Managerto set anysystemd-user.conf(5)option directly. For example, replacesystemd.user.extraConfig = "DefaultTimeoutStartSec=60";withsystemd.user.settings.Manager.DefaultTimeoutStartSec = 60;.services.timesyncd.extraConfighas been removed in favor of the structuredservices.timesyncd.settings.Timeoption. Useservices.timesyncd.settings.Timeto set anytimesyncd.conf(5)option directly. For example, replaceservices.timesyncd.extraConfig = "PollIntervalMaxSec=180";withservices.timesyncd.settings.Time.PollIntervalMaxSec = 180;.services.firezone.server.provisionhas been removed due to it being unmaintanable. Remove all uses of provisioning and use the WebUI to configure firezone.The
services.syncthingmodule now updates the Syncthing REST API using partial updates (PATCH) instead of full replacements (PUT) for general settings. Updating these settings was broken and prone to errors after updates, see #428808 and #528889. As a result, settings modified manually through the Syncthing Web UI that are not explicitly defined in your Nix configuration will now persist across rebuilds.services.plantuml-server.packages.jettynow supportsjetty_12, it no longer supportsjetty_11.
Other Notable Changes
komodohas been updated to the v2 release line (2.x). See the upstream v1 → v2 upgrade guide.security.run0.enableSudoAliasnow uses therun0-sudo-shiminstead of a shell-script to improve compatibility.With
system.etc.overlay.mutable = false, NixOS now ships an empty/etc/machine-idin the image. Previously the file was absent and systemd loggedSystem cannot boot: Missing /etc/machine-id and /etc/ is read-onlywhileConditionFirstBootfired on every boot. With this change, systemd now overlays a transient ID from/run/machine-idfor the session, andsystemd-machine-id-commit.servicehasConditionFirstBootso it writes the machine-id through to a persistent backing file when one is bind-mounted over/etc/machine-id. To persist the machine-id across reboots, bind-mount a writable file containinguninitializedover/etc/machine-idfrom the initrd, or setsystemd.machine_id=on the kernel command line (usesystemd.machine_id=firmwareto derive a stable ID on hardware that supports it).security.run0.persistentAuthoptions have been added to support persistent Authentication of session. Timeout configurable viasecurity.polkit.settings.Polkitd.ExpirationSeconds.boot.loader.systemd-bootgained support for Automatic Boot Assessment via the newboot.loader.systemd-boot.bootCountingoptions, allowing automatic detection of and recovery from bad NixOS generations. As part of this change, boot loader entries on the ESP/XBOOTLDR partition are now namednixos-<content-hash>.confinstead ofnixos-generation-<n>.conf; existing entries are migrated automatically on the nextnixos-rebuild boot/switch.services.nginxgained aluaoption to enable Lua scripting via OpenResty’s lua-nginx-module on a stock nginx, configuringlua_package_path/lua_package_cpathfrom the packages listed inservices.nginx.lua.extraPackages. Use this to add Lua to a regular nginx; for the full OpenResty platform (libraries that rely on its bundled lualib, such aslua-resty-openidc), setservices.nginx.packagetopkgs.openrestyinstead — the option configures the Lua search path for it too.security.polkit.settingsadded for RFC42 style configuration of the polkitd daemon.The
programs.fusemodule, which provides thefusermount3executable and the/etc/fuse.confconfig file, is now opt-in. The obligation to enable it has been shifted to its various consumers (e.g. gvfs, flatpak, appimage, sshfs). This can break fuse consumers at runtime, that don’t explicitly declare that dependency with a module, e.g the mounting functionality in various backup tools (borg, restic, rclone, …).services.plausiblecan now again seed an initial admin user declaratively viaservices.plausible.adminUser.email. This makes fully declarative deployments safer: Otherwise the user needed to either accept Plausible’s unauthenticated “first launch” setup wizard, which lets anyone reaching the instance create the first admin account, or do more work (deploying with NixOS’s default binding tolocalhostwithout exposing it publicly, going through the wizard, and then deploying Plausible exposed to the Internet). This option was previously removed with NixOS 25.05 due to an upstream Plausible change making declarative admin creation more difficult, but this change re-implements the admin creation directly.The
newuidmapandnewgidmapsecurity wrappers are now installed withcap_setuid/cap_setgidfile capabilities instead of the setuid-root bit, matching shadow’s--with-fcapsinstall mode and other major distributions. Rootless containers (podman, docker-rootless, unprivileged user namespaces) are unaffected. The only behavioural change is that mapping host uid 0 via/etc/subuid(which NixOS never configures by default) additionally requirescap_setfcap; users who explicitly grant uid 0 in a subuid range can restore the previous behaviour withsecurity.wrappers.newuidmap.capabilities = lib.mkForce "cap_setuid,cap_setfcap+ep";.zoneminderhas been updated to 1.38.x release. See upstream release note. While database migration should happen automatically, it’s recommended that you make a backup of the database before upgrading your system.
Release 26.05 (“Yarara”, 2026.05/30)
Highlights
Stage 1 (a.k.a. initrd) is now based on systemd by default, and the old scripted implementation is deprecated and scheduled for removal in 26.11. If you run into issues migrating, you can get help from the community or report an issue on GitHub.
You can temporarily revert to the scripted stage 1 implementation by disabling
boot.initrd.systemd.enable, but this is discouraged.Most incompatibilities will be explained with assertions during configuration evaluation, but be aware of the following that can’t be automatically detected:
If you use LUKS disk encryption, ensure that
fileSystems."/".deviceis set to"/dev/mapper/<name>", where<name>matches the name in yourboot.initrd.luks.devices.<name>definition, to avoid systemd timing out while prompting for a passphrase. If you have a more complex setup, e.g. with LVM on top of LUKS, you may need to add"x-systemd.device-timeout=infinity"tofileSystems."/".optionsinstead. If you need to disable the timeout before you can boot into the system, passsystemd.default_device_timeout_sec=infinityon the kernel command line.The
cryptsetup-askpassprogram is not available; usesystemctl defaultinstead, which will prompt for passphrases as necessary. If you pipe password responses into SSH over stdin, usessh -o RequestTTY=forceto ensuresystemctl defaultgets a TTY to prompt on.Many kernel parameters have been replaced with native systemd versions; see the section called “Boot Problems”.
/dev/rootis not available with the systemd stage 1. In the old scripted stage 1,/dev/rootwas a symlink created by the init script from theroot=kernel command line. With systemd stage 1, this symlink is not provided. If your configuration uses/dev/rootinfileSystems, replace it with a stable device path such as/dev/disk/by-label/...,/dev/disk/by-uuid/..., or the appropriate/dev/mapper/...path.
The system.nix file has been added as an alternative entry point to configuration.nix (and flake.nix) that allows configuring NixOS without using
nix-channel. This file must evaluate to a NixOS system derivation or an attribute set of such derivations, in which case the attribute to build has to be selected with the--attroption ofnixos-rebuildornixos-install. For example,# system.nix let # Pinned Nixpkgs archive # # Use `curl -I https://channels.nixos.org/nixos-26.05` to get the # latest commit of the stable channel and `nix-prefetch-url --unpack` # to compute its sha256 hash. nixpkgs = builtins.fetchTarball { url = "https://github.com/NixOS/nixpkgs/archive/c217913993d6.tar.gz"; sha256 = "026mprs324330pfazlgbw987qmsa8ligglarvqbcxzig2kgw0lqg"; }; in import "${nixpkgs}/nixos" { # Build NixOS using an external configuration.nix file, # or directly set your options here configuration = ./configuration.nix; }The default location of system.nix is
/etc/nixos/system.nixand can be changed by setting the<nixos-system>search path.nixos-rebuildandnixos-installcan now also load a system.nix file in the current directory (only if--attris used) or from a directory specified with--file.The default kernel package has been updated from 6.12 to 6.18. All supported kernels remain available.
The default D-Bus implementation has been switched from
dbustodbus-broker. dbus-broker provides higher performance and reliability while maintaining compatibility with the D-Bus reference implementation.Note that changing
services.dbus.implementationis a switch inhibitor: switching between implementations requires a reboot rather than justnixos-rebuild switch, because restarting D-Bus mid-session is unsafe.Users who wish to keep the classic daemon can set:
services.dbus.implementation = "dbus";The NixOS integration test driver now supports
systemd-nspawncontainers as an alternative backend to QEMU virtual machines (#470248, #478109, #479968). Most NixOS integration tests do not require a full VM, and switching them to containers can considerably reduce test time and resource usage. Container-based tests also run fine on Nix builders that are themselves VMs without KVM, and because containers can bind-mount host device nodes, they make it possible to exercise GPU/CUDA workloads from within NixOS integration tests. See the NixOS manual section on writing tests for details on how to opt in and on the limitations of the container backend.Coincidentally the driver now exposes machines to the testScript using their attr name used in the test module. E.g. a machine declared with
nodes.<name> = …is now available as<name>. Before, the test driver used theirsystem.nameoption value. They both default to the same value, but if you have set both independently, you might need to adapt your testScript.
New Modules
services.autossh-ng.sessionsNixOS module was introduced as a simpler alternative to the existingservices.autossh.sessionsmodule.services.nextcloud-spreed-signaling NixOS module has been added to facilitate declarative management of a standalone Spreed signaling server (“High Performance Backend” for Nextcloud Talk).
OpenThread Border Router, a Thread border router for POSIX-based platforms that bridges Thread mesh networks to IP networks. Available as services.openthread-border-router.
Atuin, magical shell history — sync, search and backup your terminal history. Available as programs.atuin.
Meshtastic, an open-source, off-grid, decentralised mesh network designed to run on affordable, low-power devices. Available as services.meshtasticd.
Goupile, an open-source design tool for secure forms including Clinical Report Forms (eCRF). Available as services.goupile.
knot-resolver, in version 6. Available as services.knot-resolver. A module for knot-resolver 5 was already available as services.kresd.
ImmichFrame, display your photos from Immich as a digital photo frame. Available as services.immichframe.
adw-bluetooth, a GNOME-inspired LibAdwaita Bluetooth applet. Available as services.adw-bluetooth.
PdfDing, manage, view and edit your PDFs seamlessly on all your devices wherever you are. Available as services.pdfding.
mangowc, a lightweight and feature-rich Wayland compositor based on dwl. Available as programs.mangowc.
reaction, a daemon that scans program outputs for repeated patterns, and takes action. A common usage is to scan ssh and webserver logs, and to ban hosts that cause multiple authentication errors. A modern alternative to fail2ban. Available as services.reaction.
vinyl-cache as the Varnish Cache project renamed itself. Available as services.vinyl-cache. To aid the migration, the old services.varnish module is still available.
papra, an open-source document management platform designed to help you organize, secure, and archive your files effortlessly. Available as services.papra.
rqbit, a bittorrent client written in Rust. It has HTTP API and Web UI, and can be used as a library. Available as services.rqbit.
Tailscale Serve, configure Tailscale Serve for exposing local services to your tailnet. Available as services.tailscale.serve.
qui, a modern alternative webUI for qBittorrent, with multi-instance support. Written in Go/React. Available as services.qui.
kiwix-serve, a service that serves ZIM files (such as Wikipedia archives) over HTTP. Available as services.kiwix-serve.
matterjs-server, a Matter controller with a Home Assistant compatible WebSocket API. Available as services.matterjs-server.
Remark42, a self-hosted comment engine. Available as services.remark42.
LibreChat, open-source self-hostable ChatGPT clone with Agents and RAG APIs. Available as services.librechat.
nohang, a daemon for Linux that prevents out of memory (OOM) situations from affecting system responsiveness. Available as services.nohang.
clevis-luks-askpass, automatic LUKS unlocking in initrd using clevis token bindings stored in LUKS headers. Available as boot.initrd.clevisLuksAskpass.
bentopdf, a privacy-first PDF toolkit running completely in-browser. Available as services.bentopdf.
hyprwhspr-rs, a keybind activated speech-to-text voice dictation utility built for use with Hyprland. Available as services.hyprwhspr-rs.
DankMaterialShell, a complete desktop shell for Wayland compositors built with Quickshell. Available as programs.dms-shell.
pyroscope, a continuous profiling platform that allows for performance debugging. Available as services.pyroscope.
dms-greeter, a modern display manager greeter for DankMaterialShell that works with greetd and supports multiple Wayland compositors. Available as services.displayManager.dms-greeter.
dsearch, a fast filesystem search service with fuzzy matching. Available as programs.dsearch.
Rustical, a CalDav/CardDav server aiming to be simple, fast and passwordless. Available as services.rustical.
Elephant, a data provider service and backend for building custom application launchers. Available as services.elephant.
Dunst, a lightweight and customizable notification daemon. Available as services.dunst.
cocoon, a PDS (personal data server) that is an alternative to the Bluesky PDS. Available as services.cocoon.
Ente Auth, an open source 2FA authenticator, with end-to-end encrypted backups. Available as programs.ente-auth.
linkding, a self-hosted bookmark manager designed to be minimal, fast, and easy to set up. Available as services.linkding.
gs1200-exporter, a Prometheus exporter for Zyxel GS1200 series switches. Available as services.gs1200-exporter.
Tinyauth, a simple authentication middleware for web apps, with OAuth and LDAP support. Available as services.tinyauth.
Strichliste, a digital self-service tallysheet used in hackerspaces, clubs and offices. Available as services.strichliste.
Dawarich, a self-hostable location history tracker. Available as services.dawarich.
Howdy, a Windows Hello™ style facial authentication program for Linux. Available as services.howdy
SuiteNumérique Drive, a collaborative file sharing and document management platform that scales. Built with Django and React. Open source alternative to Sharepoint or Google Drive. Available as services.lasuite-drive.
linux-enable-ir-emitter, a tool used to set up IR cameras, used with Howdy. Available as services.linux-enable-ir-emitter.
udp-over-tcp, a tunnel for proxying UDP traffic over a TCP stream. Available as
services.udp-over-tcp.udp2tcpandservices.udp-over-tcp.tcp2udp.turborepo-remote-cache, an open-source implementation of the Turborepo custom remote cache server. Available as services.turborepo-remote-cache.
RSSHub, a service to convert many sources into rss. Available as services.rsshub.
ReFrame, a DRM/KMS based remote desktop for Linux that supports Wayland/NVIDIA/headless/login. Available as services.reframe
Komodo Periphery, a multi-server Docker and Git deployment agent by Komodo. Available as services.komodo-periphery.
Shoko, an anime management system. Available as services.shoko.
perses, the open dashboard tool for Prometheus and other data sources. Available as services.perses.
Drasl, an alternative authentication server for Minecraft. Available as services.drasl.
tabbyAPI, the official OpenAI compatible API server for Exllama. Available as services.tabbyapi.
Tdarr, Audio/Video Library Analytics & Transcode/Remux Automation. Available as services.tdarr.
Headplane, a feature-complete Web UI for Headscale. Available as services.headplane.
whois, an intelligent WHOIS client. Available as programs.whois.
porxie, a correct and efficient ATProto blob proxy for secure content delivery. Available as services.porxie.
LogiOps, an unofficial userspace driver for HID++ Logitech devices. Available as services.logiops.
Backward Incompatibilities
services.openssh.settings.AcceptEnvis now explicitly defined as an option that takes a list of strings, to facilitate option merging. Setting it to a string value is no longer supported.The default packages in
services.jenkins.packageshave been dropped, since not every Jenkins installation needs any package at all. It’s more reasonable to leave it empty and let users configure what they need.services.taskchampion-sync-server module has had an option
services.taskchampion-sync-server.dynamicUseradded to use systemd’s DynamicUser feature. This is enabled by default when stateVersion is at least 26.05, and disabled otherwise. If you need this feature, you need to setservices.taskchampion-sync-server.dynamicUsertotrueand migrate/var/lib/taskchampion-sync-serverto/var/lib/private/taskchampion-sync-server.The programs.captive-browser module no longer falls back on a setcap wrapper around udhcpc to discover your network’s DNS server due to GHSA-wc3r-c66x-8xmc (CVE-2026-25740). If you’re using this module, you must either configure
programs.captive-browser.dhcp-dnsmanually or enable one of NetworkManager, dhcpcd, or systemd-networkd.The services.yggdrasil module has been refactored with the following breaking changes:
The
services.yggdrasil.configFileoption has been removed. Configuration should now be specified directly viaservices.yggdrasil.settings.The
services.yggdrasil.persistentKeysoption has been removed. To maintain persistent keys and IPv6 addresses across reboots, useservices.yggdrasil.settings.PrivateKeyPathto securely load your private key from a file via systemd credentials. The private key must be in PEM format (PKCS #8).Storing
PrivateKeydirectly insettingsis now explicitly forbidden to prevent keys from being stored world-readable in the Nix store.If you previously used
configFile, migrate your configuration to thesettingsoption and extract the private key to a separate file referenced byPrivateKeyPath.If you previously used
persistentKeys, convert your keys to PEM format and store them in a secure location accessible only to root, then reference them viaPrivateKeyPath.
services.xserver will now throw an error if an X11 driver specified in
videoDriver(s)cannot be found. Previously, unknown drivers would be silently ignored.The
services.avahi.wideAreaoption now defaults tofalseas a mitigation againstCVE-2024-52615/GHSA-x6vp-f33h-h32g.systemd.coredump.extraConfighas been removed in favor of the structuredsystemd.coredump.settings.Coredumpoption. Usesystemd.coredump.settings.Coredumpto set anycoredump.conf(5)option directly. For example, replacesystemd.coredump.extraConfig = "Storage=journal";withsystemd.coredump.settings.Coredump.Storage = "journal";.services.home-assistant.config.lovelace.modehas been renamed tolovelace.dashboardsandlovelace.resource_modeto match the configuration format required by Home Assistant 2026.8. Users who explicitly setlovelace.modeshould remove it; the module generates the correct entries automatically.fulcrumhas been updated to 2.x. If run against an existing v1.x database without the--db-upgradeflag it refuses to start; the upgrade takes around an hour on Bitcoin mainnet.opentrack,slushload,synthesia,vtfedit,winbox,wineasio, andyabridgeuse wineWow64Packages instead of wineWowPackages as wine versions >= 11.0 have deprecated wineWowPackages. As such, the prefixes for these packages are NOT backwards compatible and need to be regenerated with potential for data loss.profiles/hardenedhas been removed, because:It lacks a consistent and transparent baseline or standard,
It may introduce unexpected breakage or degrade performance without clear benefit,
It is difficult to manage user expectations, especially since the implications of enabling it are not always obvious,
and as multiple contributors have noted, it is often more of a “grab bag” of settings than a cohesive security policy.
See NixOS Hardening wiki page for hardening options.
services.crabfitwas removed because its upstream packages are unmaintained and insecure.services.opensnitch.settings.Rules.Path now defaults to
/var/lib/opensnitch/rulesinstead of the previous/etc/opensnitchd/rulesbecause it contains mutable data.services.mosquitto now generates per-listener authentication and access control via the upstream
password-fileandacl-fileplugins instead of the deprecatedpassword_fileandacl_fileoptions. The plugins contain the same code, so behaviour is unchanged, butservices.mosquitto.packagemust now be at least version 2.1.sing-boxhas been updated to 1.13.0, which has removed some deprecated options. See upstream documentation for details and migration options.services.statsdhas been removed because the packages it relies on do not exist anymore in nixpkgs.services.pyloadhas been removed because the package it relies on does not exist anymore in nixpkgs due to vulnerabilities and being unmaintained.Removed the ability from systemd to start units installed via
nix-env -i. This feature is hardly used and most units do not work without NixOS specific changes anyways. Removing this allows us to drop a custom systemd patch improving systemd maintainability and update speed.Removed the ability from systemd to depend on open-yet-unformatted dm-crypt devices as systemd device units. For example you cannot call systemd-makefs on such devices. This was never implemented upstream but patched into Nixpkgs’s systemd. Removing this allows us to drop a custom systemd patch improving systemd maintainability and update speed.
linux_hardenedkernel has been removed due to a lack of maintenance.services.tandoor-recipes now uses a sub-directory for media files by default starting with
26.05. Existing setups should move media files out of the data directory and adjustservices.tandoor-recipes.extraConfig.MEDIA_ROOTaccordingly. See Migrating media files for pre 26.05 installations.linux-rtkernel has been removed due to a lack of maintenance.rusticwas upgraded to0.11.x, which contains breaking changes to command-line parameters and configuration file.The packages
iwandwirelesstools(iwconfig,iwlist, etc.) are no longer installed implicitly if wireless networking has been enabled.The
fileSystems.<name>.fsTypeoption no longer has a default value and must be specified by the user. The value"auto"still works as before, though its use is generally discouraged.services.uptimehas been removed because the package it relies on does not exist anymore in nixpkgs.services.mattermost now defaults to version 11, which has dropped support for MySQL in favor of Postgres. As a result, all support for MySQL has been removed from the module. See the migration steps if you were not running Postgres. Note that version 11 also restricts the user limit to 250 by default; see the
pkgs.mattermostremoveUserLimit and removeFreeBadge options combined withservices.mattermost.packageto change this behavior. For example:
{
services.mattermost.package = pkgs.mattermost.override {
removeUserLimit = true;
removeFreeBadge = true;
};
}
post-resume.targethas been removed. See systemd.special(7) aboutsleep.targetfor instructions on ordering a process after resume withExecStop=.services.vsftpd no longer automatically configures a PAM module. This means configurations using
services.vsftpd.localUserswill no longer work unlessservices.vsftpd.enableVirtualUsersandservices.vsftpd.userDbPathare also configured. The old behaviour can be restored by settingsecurity.pam.services.vsftpd.enable = true, although this only ever worked by accident and may not be secure.services.kubernetes.addons.dns.corednshas been renamed toservices.kubernetes.addons.dns.corednsImageand now expects a package instead of attrs. Now, by default, nixpkgs.coredns in conjunction withdockerTools.buildImageis used, instead of pulling the upstream container image from Docker Hub. If you want the old behavior, you can set:
{
services.kubernetes.addons.dns.corednsImage = pkgs.dockerTools.pullImage {
imageName = "coredns/coredns";
imageDigest = "sha256:af8c8d35a5d184b386c4a6d1a012c8b218d40d1376474c7d071bb6c07201f47d";
finalImageTag = "v1.12.2";
hash = "sha256-ZgXEyxVrdskQdgg0ONJ9sboAXEEHTgNsiptk5O945c0=";
};
}
services.stalwart-mailhas been renamed toservices.stalwartto align with upstream re-brand as an e-mail and collaboration server. Other notable breaking changes to module:Addition of module-specific
stateVersionoption, which on existing installations of Stalwart must be set to the same assystem.stateVersion.This enables manually and carefully migrating Stalwart to a new
stateVersionor newly enabling the Stalwart module with a newerstateVersionthansystem.stateVersion.systemd.services.stalwartowned bystalwart:stalwart. Theuserandgroupare configurable viaservices.stalwart.userandservices.stalwart.group, respectively. By default, ifstateVersionis older than26.05, will fallback to legacy value ofstalwart-mailfor bothuserandgroup.Default value for
services.stalwart.dataDirhas changed to/var/lib/stalwart. IfstateVersionis older than26.05, will fallback to legacy value of/var/lib/stalwart-mail.Default tracer name and type have changed to
journal. IfstateVersionis older than26.05, will fallback to legacy value ofstdout.
services.eintopfhas been renamed to services.lauti to align with upstream re-brand as a community online calendar.services.oauth2-proxy.clientSecretandservices.oauth2-proxy.cookie.secrethave been replaced withservices.oauth2-proxy.clientSecretFileandservices.oauth2-proxy.cookie.secretFilerespectively. This was done to ensure secrets don’t get made world-readable.services.grafana.settings.security.secret_keydoesn’t have a default value anymore. Please generate your own key or hard-code the old one (“SW2YcwTIb9zpOOhoPsMm”) explicitly. See the upstream docs and the instructions on how to rotate for further information.Please do note that there’s no official way to rotate. On a single-node instance with the database and the secret-key being on the same filesystem with the same permissions for Grafana only to read, it is most likely OK to keep using the old key.
If you need to rotate, a 3rd-party tool,
grafana-secretkey-rotation-toolis a tested option. When using a secret for this value, make sure to use Grafana’s variable expansion to inject secrets.services.promtailhas been removed, aspromtailreached its end of life. Consider migrating toservices.alloy.enable, or, if you are looking for something light-weight,services.fluent-bit.enable. See https://grafana.com/docs/alloy/latest/set-up/migrate/ or https://docs.fluentbit.io/manual/data-pipeline/outputs/loki.Ethercalc and its associated module have been removed, as the package is unmaintained and cannot be installed from source with npm now.
services.immich no longer supports pgvecto.rs since the package has been removed from nixpkgs. As a result, options
services.immich.database.enableVectorsandservices.immich.database.enableVectorchordhave been removed, and VectorChord is now always used. If you have not completed the migration yet, ensure you completely remove the extension from your database before upgrading by following the migration guide.services.cgitbefore always had the git-http-backend and its “export all” setting enabled, which sidestepped any access control configured in cgit’s settings. Now you have to make a decision and either enable or disableopt-services.cgit.<name>.gitHttpBackend.checkExportOkFiles(or disable the git-http-backend).rocmPackages_6has been removed.rocmPackageshas been updated to ROCm 7.x. Out of tree packages may rely on obsolete hipblas APIs or compile time constant warp size and need to be updated.mysql80has been removed. Please update tomysql84ormariadb. See the upgrade guide for more information.services.prometheus.exporters.rspamdhas been removed. It relied on the Rspamd /stat endpoint via the JSON exporter. You can use the Rspamd /metrics endpoint directly instead.The Bash implementation of the
nixos-rebuildprogram is removed. All switchable systems now use the Python rewrite. Any prior usage ofsystem.rebuild.enableNgmust now be removed. If you have any outstanding issues with the new implementation, please open an issue on GitHub.services.desktopManager.gnome no longer installs the Geary e-mail client since it is not part of the GNOME core applications list. Geary’s position in the default favorite apps section has been replaced by GNOME Text Editor. To keep it installed, add
programs.geary.enable = true;to your configuration.walkerhas been updated to 2.0.0+, which is a complete rewrite in rust.It now requires a running
elephantapplication launcher backend service, which can be enabled using the newservices.elephant.enable.The way keybinds and actions are handled have been completely revamped. Please refer to the default config.
services.portunus has been upgraded to 2.2.0, which includes a bug fix that may cause existing databases to be rejected if user accounts are configured with malformed email addresses. Please refer to the upstream release announcement for details and instructions on how to fix problematic database entries.
Support for
reiserfsin nixpkgs has been removed, following the removal in Linux 6.13.services.tor no longer bind mounts Unix sockets of onion services into its chroot because it was not reliable. Users should do it themselves using either
JoinsNamespaceOf=and Unix sockets in/tmporBindPaths=from a persistent parent directory of each Unix socket. See https://github.com/NixOS/nixpkgs/issues/481673.support for
ecryptfsin nixpkgs has been removed.services.xserver.cmthas been removed as thexf86-input-cmtpackage was broken and unmaintained upstream.programs.lightwas removed from nixpkgs due to the corresponding package being unmaintained upstream.brightnessctland hardware.acpilight offer replacements.cephhas been upgraded to v20. See the Ceph “tentacle” release notes for details and recommended upgrade procedure. Note that upgrades of server-side components are one-way, and downgrading e.g. an OSD from Tentacle to Squid is not just not supported but is known to break.services.unifi.jrePackagenow defaults tojdk25_headlessinstead ofjdk17_headless, in order to be compatible with new versions ofunifi.The networking.wireless module has been security hardened by default: the
wpa_supplicantdaemon now runs under an unprivileged user with restricted access to the system.As part of these changes,
/etc/wpa_supplicant.confhas been deprecated: the NixOS-generated configuration file is now linked to/etc/wpa_supplicant/nixos.confand/etc/wpa_supplicant/imperative.confhas been added for imperatively configuringwpa_supplicantor when using allowAuxiliaryImperativeNetworks.If client certificates, keys or other files are needed, these should be stored under
/etc/wpa_supplicantand owned bywpa_supplicantto ensure the daemon can read them.Similarly, the
ctrl_interfacedirectory set inwpa_supplicant’s conf must be writeable by thewpa_supplicantuser so that thewpa_supplicantdaemon can start successfully. If you were changingctrl_interfacein extraConfig or in/etc/wpa_supplicant/imperative.conf, please remove that line.Also, the
networking.wireless.userControlled.groupoption has been removed since there is now a dedicatedwpa_supplicantgroup to control the daemon, andnetworking.wireless.userControlled.enablehas been renamed tonetworking.wireless.userControlled.No functionality should have been impacted by these changes (including controlling via
wpa_cli, integration with NetworkManager or connman), but if you find any problems, please open an issue on GitHub. If necessary, the security hardening can be reverted withnetworking.wireless.enableHardening.Note for NetworkManager users: before these changes NetworkManager used to spawn its own wpa_supplicant daemon, but now it relies on
networking.wireless. So, if you hadnetworking.wireless.enable = falsein your configuration, you should remove that line.Some implementation details of the NixOS network-interfaces module have been changed:
In the “scripted” backend,
network-setup.servicehas been removed and the network configuration services are now part ofnetwork.target, which is now directly pulled intomulti-user.target.Interface addresses, routes and default gateways are now configured asynchronously as soon as the underlying network devices become available (fixes issue #154737).
In both “networkd” and “scripted” backends, the configuration of name servers is now part of
network-local-commands.service(fixes issue #445496).The issue that resulted in a completely unconfigured network if both
resolvconfwas disabled and no default gateway configured, has also been fixed.
In the PowerDNS Recursor module, following the deprecation period started with NixOS 25.05, the option
services.pdns-recursor.old-settingshas been removed andservices.pdns-recursor.yaml-settingsconsequently renamed toservices.pdns-recursor.settings.services.angrr now uses TOML for configuration. Define policies with
services.angrr.settings(generate TOML file) or point to a file usingservices.angrr.configFile. The legacy optionsservices.angrr.period,services.angrr.ownedOnly, andservices.angrr.removeRoothave been removed. Seeman 5 angrrand the description ofservices.angrr.settingsoptions for examples and details.services.homepage-dashboard.environmentFilehas been renamed toservices.homepage-dashboard.environmentFiles, and now expects a list of strings.services.pingvin-sharehas been removed as thepingvin-share.backendpackage was broken and the project was archived upstream.services.jellyseerrhas been renamed to services.seerr following the upstream changes. Notable breaking changes:systemd service name changed accordingly.
Default config directory moved from
/var/lib/jellyseerr/configto/var/lib/seerr/.If
stateVersionis older than26.05, the module fall backs to the legacy path value.
services.vikunja has been updated to Vikunja v1.0.0, which introduces multiple breaking changes. Notable breaking changes:
CORS is enabled by default. The module now sets
services.vikunja.settings.service.publicurlby default. Custom overrides must ensure it is set or disable CORS, otherwise Vikunja will fail to start.API route and response changes may affect integrations.
Configuration format and option changes require review of existing settings (including OpenID provider configuration and metrics/log settings).
SQLite paths are now relative to
service.rootpathunless absolute. Startup now validates file storage and OAuth providers.
services.xtreemfshas been removed as thextreemfspackage was broken and unmaintained upstream.opengfwpackage andservices.opengfwmodule have been removed as the upstream GitHub repository and website have been shut down.services.esphome no longer uses
DynamicUser. The service now runs as a staticesphomesystem user. systemd handles the migration from/var/lib/private/esphomeautomatically, but users with impermanence setups should ensure/var/lib/esphomeis persisted.programs.pqos-wrappermodule has been deleted as the corresponding package has been dropped from nixpkgs.programs.benchexec.enable = trueno longer setsprograms.pqos-wrapper.enable = trueas the corresponding module has been deleted.
Other Notable Changes
Reloading or restarting systemd units from the NixOS activation script is deprecated, and will be removed in NixOS 26.11. This deprecation is part of a bigger effort to deprecate activation scripts altogether, which will take place over several releases. There are no in-tree usages of the now-deprecated reload/restart functionality.
Switch inhibitors were introduced, which add a pre-switch check that compares a list of strings between the previous and the new generation, and refuses to switch into the new generation when there is a difference between the two lists. This allows avoiding switching into a system when for instance the systemd version changed by adding
config.systemd.package.versionto the switch inhibitors for your system. You can still forcefully switch into any generation by settingNIXOS_NO_CHECK=1.switch-to-configurationnow reloads a service instead of restarting it when the only change to its unit isExecReload=, and takes no action whenExecReload=is removed. Previously both cases triggered a restart.hardware.nvidia.branchwas added to select the NVIDIA driver branch; settinghardware.nvidia.packageoverrides this.The NixOS NVIDIA module wiring has been updated to match the new
nvidia-x11output layout.nixos/nvidianow uses EGL external platform ICD libraries built from source (egl-gbm,egl-wayland,egl-wayland2,egl-x11) instead of relying on vendor-provided binaries for these components.hardware.nvidia.moduleParamswas added to configure NVIDIA kernel module parameters declaratively. These parameters are now written tomodprobeconfiguration instead of being passed through global kernel command-line parameters.hardware.xpadneo now supports configuring kernel module parameters via a freeform settings option, with convenience options for rumble attenuation and controller quirks.
security.acmenow defaults to a dynamic renewal duration, if security.acme.defaults.validMinDays remains unset. This accommodates certificates with different ACME profile:For certificates with a total validity at or above 10 days renewal will happen after two thirds of the lifetime has passed (e.g. a certificate valid for 90 days renews once the validity falls below 30 days)
For shortlived certificates with a total validity below 10 days renewal will happen after half of the total lifetime has passed
The module for the Dovecot IMAP server, services.dovecot2, now uses RFC-42-style settings, exposing a structured interface to write the configuration file.
Also see the list of available settings for Dovecot 2.3 or 2.4.
fonts.fontconfig.useEmbeddedBitmapsis now set totrueby default.services.frp now supports multiple instances through
services.frp.instancesto make it possible to run multiple frp clients or servers at the same time.services.resolved module was converted to RFC42-style settings. The moved options have also been renamed to match the upstream names. Aliases mean current configs will continue to function, but users should move to the new options as convenient.
systemd.sleep.extraConfigwas replaced by RFC 0042-compliantsystemd.sleep.settings.Sleep, which is used to generate thesleep.confconfiguration file. See sleep.conf.d(5) for available options.Support for Bluetooth audio based on
bluez-alsahas been added to the hardware.alsa module. It can be enabled with the new enableBluetooth option.services.atuin now has an
environmentFileoption to safely allow configuring secrets, such as anATUIN_DB_URIcontaining a Postgres password.systemd.network.*has been updated to support all configuration options from upstreamnetworkdversion 259.networking.resolvconf.enablenow defaults totrueunconditionally instead of!(config.environment.etc ? "resolv.conf"). If you setenvironment.etc."resolv.conf"yourself, then you should also setnetworking.resolvconf.enable = false.The services.drupal module has a few improvements aimed at making it better for installing custom Drupal instances, namely a new
webRootoption for identifying custom webroots in source code, a newconfigRootoption for identifying and synchronizing config yamls onto NixOS, and some new settings for managing variable content and filepaths.services.openssh now supports generating host SSH keys by setting
services.openssh.generateHostKeys = truewhile leavingservices.openssh.enabledisabled. This is particularly useful for systems that have no need of an SSH daemon but want SSH host keys for other purposes such as using agenix or sops-nix.services.openssh.enableRecommendedAlgorithmshas been added to allow users to opt out of NixOS’s curated set of recommended algorithms. This set to true by default, and thus is not a breaking change. Users may want to set this to false if they prefer upstream’s default algorithms. See https://github.com/NixOS/nixpkgs/pull/471330.services.openssh.bannerhas been removed. Useservices.openssh.settings.Bannerinstead.IPVLAN interfaces can now be configured through the
networking.ipvlansoption in the networking module.services.caddy now supports setting
services.caddy.httpPortandservices.caddy.httpsPortand opening them in the firewall viaservices.caddy.openFirewall.The latest available version of Nextcloud is v33 (available as
pkgs.nextcloud33). The installation logic is as follows:If
services.nextcloud.packageis specified explicitly, this package will be installed (recommended)If
system.stateVersionis >=26.05,pkgs.nextcloud33will be installed by default.If
system.stateVersionis >=25.11,pkgs.nextcloud32will be installed by default.nextcloud31is EOL and was thus removed.Please note that an upgrade from v31 (or older) to v33 directly is not possible. Please upgrade to
nextcloud32(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud32;.
InvoicePlane with the Caddy webserver (
services.invoiceplane.webserver = "caddy") now sets up sites with Caddy’s automatic HTTPS instead of HTTP-only. To keep the old behavior for a siteexample.com, setservices.caddy.virtualHosts."example.com".hostName = "http://example.com". If you set custom Caddy options for a InvoicePlane site, migrate these options by removinghttp://fromservices.caddy.virtualHosts."http://example.com".services.slurmnow supports slurmrestd usage through theservices.slurm.rest.enableNixOS options.The
networking.firewall.logRefusedConnectionsoption now defaults tofalse. Logging of refused or dropped incoming connections can generate a very high volume of kernel log messages on internet-facing systems, causing the kernel ring buffer (dmesg) to rotate quickly and potentially discard more relevant diagnostic information.The services.calibre-web systemd service has been hardened with additional sandboxing restrictions.
services.kanidmoptions for server, client and unix were moved under dedicated namespaces. For each componentenableComponentandcomponentSettingsare nowcomponent.enableandcomponent.settings. The unix module now supports using SSH keys from Kanidm viaservices.kanidm.unix.sshIntegration = true.services.radicle now supports importing the private key and passphrase as systemd creds.
Release 25.11 (“Xantusia”, 2025.11/30)
Highlights
Added
nixos-init, a Rust-based bashless initialization system for systemd initrd.COSMIC DE has been updated to the beta version, bringing it closer to its first stable release. This includes updates to its core components, applications, and overall stability.
FirewallD support has been added. It can be configured both as a standalone service (through
services.firewalld), and as a backend to the existingnetworking.firewalloptions.GNOME has been updated to version 49.
Removes X11 session support. Though you can still run X11 apps using XWayland.
gnome-session’s custom service manager was removed in favour of using systemd.
GDM now allows multiple seats, which is useful for e.g. remote logins. Though we currently limit this to five greeter instances.
papersdocument viewer is now installed by default, replacingevince. Though we still includeevincetransitively bysushi(quick previewer used by Files/Nautilus) You can disable either usingenvironment.gnome.excludePackagesand restoreevincewithprograms.evince.enable.showtimevideo player is now installed by default, replacingtotem. You can disable it usingenvironment.gnome.excludePackagesand restoretotemwithenvironment.systemPackages.The
ibusinput method is now enabled by default, to ensure that dead keys continue to work like in GNOME <= 48. To change it, seei18n.inputMethod.enableandi18n.inputMethod.type.
Refer to the GNOME release notes for more details.
networking.firewallnow has abackendoption for choosing which backend to use.nixos-rebuild-ng, a full rewrite ofnixos-rebuildin Python, is enabled by default from this release. You can disable it by settingsystem.rebuild.enableNgtofalsein your configuration if you need, but please report any issues. It is expected that the next major version of NixOS (26.05) will remove thesystem.rebuild.enableNgoption.rEFInd, a graphical boot manager for UEFI systems, can now be used throughboot.loader.refind.enable.Secure boot support can now be enabled for the Limine bootloader through
boot.loader.limine.secureBoot.enable. Bootloader install script signs the bootloader, then kernels are hashed during system rebuild and written to a config. This allows Limine to boot only the kernels installed through NixOS system.Syncthing has been updated to version 2.0.0.
The default PostgreSQL version for new NixOS installations (i.e. with
system.stateVersion >= 25.11) is v17.The NetworkManager module does not ship with a default set of VPN plugins anymore. All required VPN plugins must now be explicitly configured in
networking.networkmanager.plugins.The Qt 5-based versions of KDE Gear, Plasma, Maui and Deepin have been removed. Users are advised to migrate to Plasma 6 and Gear 25.08, available under
kdePackages.
New Modules
Added
nixos-init, a Rust-based bashless initialization system for systemd initrd. This allows building NixOS systems without any interpreter. Enable viasystem.nixos-init.enable = true;.angrr, a service that automatically cleans up old auto GC roots. Available as services.angrr.
Auto-scrub support for Bcachefs filesystems can now be enabled through services.bcachefs.autoScrub.enable to periodically check for data corruption. If there’s a correct copy available, it will automatically repair corrupted blocks.
Beszel, a lightweight server monitoring hub with historical data, docker stats, and alerts. Available as
services.beszel.agentandservices.beszel.hub.boot.kernel.sysfs, a new way to set sysfs attributes.
Broadcast Box, a WebRTC broadcast server. Available as services.broadcast-box.
Drivers and utilities for Tenstorrent have been added. Available as hardware.tenstorrent.
byedpi, a DPI bypass service. Available as services.byedpi.
Chrysalis, a graphical configurator for Kaleidoscope-powered keyboards. Available as programs.chrysalis.
Chhoto URL, a simple, blazingly fast, selfhosted URL shortener with no unnecessary features, written in Rust. Available as services.chhoto-url.
conman, a serial console management program. Available as services.conman.
Corteza, a low-code platform. Available as services.corteza.
crowdsec, a free, open-source and collaborative IPS. Available as services.crowdsec.
crowdsec-firewall-bouncer, the CrowdSec Remediation Component for fetching new and old decisions from a CrowdSec API and adding them to a blocklist used by supported firewalls. Available as services.crowdsec-firewall-bouncer.
docuseal, a DocuSign alternative. Create, fill, and sign digital documents. Available as services.docuseal.
Draupnir, a Matrix moderation bot. Available as services.draupnir.
dwl, a compact, hackable compositor for Wayland based on wlroots. Available as programs.dwl.
ente, a service that provides a fully open source, end-to-end encrypted platform for photos and videos. Available as services.ente.api and services.ente.web.
ErsatzTV, a personal IPTV server. Available as services.ersatztv.
Fediwall, a web application for live displaying toots from mastodon, inspired by mastowall. Available as services.fediwall.
FileBrowser, a web application for managing and sharing files. Available as services.filebrowser.
FirewallD, a firewall daemon with D-Bus interface providing a dynamic firewall. Available as services.firewalld and a networking.firewall.backend.
fw-fanctrl, a simple systemd service to better control Framework Laptop’s fan(s). Available as hardware.fw-fanctrl.
go-httpbin, a reasonably complete and well-tested golang port of httpbin, with zero dependencies outside the go stdlib. Available as services.go-httpbin.
gtklock, a GTK-based lockscreen for Wayland. Available as programs.gtklock.
Homebridge, a lightweight Node.js server you can run on your home network that emulates the iOS HomeKit API. Available as services.homebridge.
IfState, manage host interface settings in a declarative manner. Available as networking.ifstate and boot.initrd.network.ifstate.
KMinion, feature-rich Prometheus exporter for Apache Kafka. Available as services.prometheus.exporters.kafka.
LACT, a GPU monitoring and configuration tool, can now be enabled through services.lact.enable. Note that for LACT to work properly on AMD GPU systems, you need to enable hardware.amdgpu.overdrive.enable.
lemurs, a customizable TUI display/login manager. Available as services.displayManager.lemurs.
LibreTranslate, a free and open source machine translation API. Available as services.libretranslate.
Linkwarden a self-hosted collaborative bookmark manager to collect, read, annotate, and fully preserve what matters, all in one place. Available as services.linkwarden.
Linyaps, a cross-distribution package manager with sandboxed apps and shared runtime. Available as services.linyaps.
llama-swap, a light weight transparent proxy server that provides automatic model swapping to llama.cpp’s server (or any server with an OpenAI compatible endpoint). Available as
services.llama-swap.enable.local-content-share, a simple web-app for storing/sharing text snippets and files in your local network. Available as services.local-content-share.
LubeLogger, a vehicle maintenance and fuel mileage tracker. Available as services.lubelogger.
mautrix-discord, a Matrix-Discord puppeting/relay bridge. Available as services.mautrix-discord.
Neat IP Address Planner (NIPAP), a sleek, intuitive and powerful IP address management system. Available as services.nipap.enable.
nebula-lighthouse-service, a public Nebula VPN lighthouse service. Available as services.nebula-lighthouse-service.
Newt, a fully user space WireGuard tunnel client and TCP/UDP proxy, designed to securely expose private resources controlled by Pangolin. Available as services.newt.
nixbit, a GUI application for updating your NixOS system from a Nix Flakes Git repository. Available as programs.nixbit.
nix-store-veritysetup, a systemd generator to unlock the Nix Store as a dm-verity protected block device. Available as boot.initrd.nix-store-veritysetup.
nvme-rs, NVMe monitoring services.nvme-rs.
Overseerr, a request management and media discovery tool for the Plex ecosystem. Available as services.overseerr.
PairDrop, a peer-to-peer file transfer web app. Available as services.pairdrop.
paisa, a personal finance tracker and dashboard. Available as services.paisa.
Pangolin, a tunneled reverse proxy server with access control. Available as services.pangolin.
Pi-hole, a DNS sinkhole for advertisements based on Dnsmasq. Available as services.pihole-ftl, and services.pihole-web for the web GUI and API.
pmount, a tool that allows normal users to mount removable devices without requiring root privileges Available as programs.pmount.
postfix-tlspol, a MTA-STS and DANE resolver and TLS policy server for Postfix. Available as services.postfix-tlspol.
Prometheus Tailscale Exporter, a Prometheus exporter for Tailscale Tailnet metrics.
Prometheus Storagebox Exporter, a Prometheus exporter for Hetzner storage boxes.
qBittorrent, a bittorrent client programmed in C++ / Qt that uses libtorrent by Arvid Norberg. Available as services.qbittorrent.
radicle-ci-broker, a tool for running CI for repositories in the local Radicle node. Available as services.radicle.ci.broker.enable.
radicle-native-ci, an adapter for the Radicle CI broker, for performing CI runs locally. Available as services.radicle.ci.adapters.native.
rauc (the Robust Auto-Update Controller), a daemon that allows reliable and secure software updates in embedded Linux systems. Available as services.rauc.
ringboard, a fast, efficient, and composable clipboard manager for Linux. Available for x11 as services.ringboard and for Wayland as services.ringboard.
rsync, an open source utility that provides fast incremental file transfer. Available as services.rsync.
Sharkey, a Sharkish microblogging platform. Available as services.sharkey.
SillyTavern, an LLM Frontend for Power Users. Available as services.sillytavern.
SuiteNumérique Docs, a collaborative note taking, wiki and documentation web platform and alternative to Notion or Outline. Available as services.lasuite-docs.
SuiteNumérique Meet, an open source alternative to Google Meet and Zoom powered by LiveKit. It features HD video calls, screen sharing, and chat features. Available as services.lasuite-meet.
Speedify, a proprietary VPN which allows combining multiple internet connections (Wi-Fi, 4G, 5G, Ethernet, Starlink, Satellite, and more) to improve the stability, speed, and security of online experiences. Available as services.speedify.
Spoolman, a inventory management system for Filament spools. Available as services.spoolman.
Sshwifty, a Telnet and SSH client for your browser. Available as services.sshwifty.
Szurubooru, an image board engine inspired by services such as Danbooru, dedicated for small and medium communities. Available as services.szurubooru.
Temporal, a durable execution platform that enables developers to build scalable applications without sacrificing productivity or reliability. Available as services.temporal.
Timekpr-nExT, a time managing application that helps optimizing time spent at computer for your subordinates, children or even for yourself. Available as
services.timekpr.enable.tlsrpt-reporter, an application suite to generate and deliver TLSRPT reports. Available as services.tlsrpt.
tsidp, a simple OIDC / OAuth Identity Provider (IdP) server for your tailnet. Available as services.tsidp.
TuneD, a system tuning service for Linux. Available as services.tuned.
tuwunel, a federated chat server implementing the Matrix protocol, forked from Conduwuit. Available as services.matrix-tuwunel.
umami, a simple, fast, privacy-focused alternative to Google Analytics. Available as services.umami.
wayvnc, a VNC server for wlroots based Wayland compositors. Available as programs.wayvnc.
XPPen, an official closed-source driver for XP Pen tablets. Available as programs.xppen.
Warpgate, an SSH, HTTPS, MySQL and Postgres bastion. Available as services.warpgate. Note that you need to run
warpgate recover-accessto recover builtin admin account, as the initialisation script uses a throwaway value to initialise its database.yubikey-manager, a tool for configuring YubiKey devices. Available as programs.yubikey-manager.
rumno, a visual pop-up notification manager. Available as services.rumno.
Backward Incompatibilities
boot.enableContainersis only turned on when a declarative NixOS container is defined incontainers. If you use thenixos-containertool for imperative container management, setboot.enableContainers = true;explicitly.Configurations with
boot.initrd.systemd.enable && !boot.initrd.enablewill have theirinitscript at$toplevel/initinstead of$toplevel/prepare-root. This is because it does not make sense for systemd stage 1 to affect theinitscript when stage 1 is entirely disabled (e.g. containers).command-not-foundpackage is now disabled by default; it works only for nix-channels based systems, and requires setup for it to work.hardware.amdgpu.amdvlkand theamdvlkpackage have been removed, as they have been deprecated by AMD. These have been replaced with the RADV driver from Mesa, which is enabled by default.firezonehas changed how theEveryonegroup behaves. Service Accounts are no longer considered part ofEveryone.i18n.inputMethod.fcitx5.plasma6Supporthas been removed because qt6 is the only one used for fcitx5-configtool now.Linux 5.4 and all its variants have been removed since mainline will reach its end of life within the support-span of 25.11.
minifluxno longer uses the hstore PostgreSQL extension. Having the extension would prevent Miniflux from starting. In case you are managing yourminifluxPostgreSQL database externally, disable the extension withDROP EXTENSION IF EXISTS hstore;.netbox-managescript created by thenetboxmodule no longer usessudo -u netboxinternally. It can be run as root and will change its user tonetboxusingrunuser.NixOS display manager modules now strictly use tty1, where many of them previously used tty7. Options to configure display managers’ VT have been dropped. A configuration with a display manager enabled will not start
getty@tty1.service, even if the system is forced to boot intomulti-user.targetinstead ofgraphical.target.programs.cardboardwas removed due to the package having been broken since at least November 2024.programs.goldwardenhas been removed, due to the software not working with newer versions of the Bitwarden and Vaultwarden servers, as well as it being abandoned upstream.programs.skim.fuzzyCompletionshas been removed in favor of adding the completions to the package itself.Prosodyhas been updated to major release 13 which removed some obsoleted modules and brought a couple of major and breaking changes:The
http_filesmodule is now disabled by default because it now requireshttp_files_dirto be configured.The
vcard_mucmodule has been removed and got replaced by the inbuiltmuc_vcardmodule.The
http_uploadmodule has been removed and you must migrate to thehttp_file_sharemodule to stay XEP-0423 compliant. ThehttpFileShareoptions got expanded to better facility that.The
admin_shellmodule is now always being loaded to makeprosodyctlfunctional.The
mime_types_filesetting is now set to"${pkgs.mailcap}/etc/mime.types"to prevent errors. For a complete list of changes, please see their announcement.
programs.riverhas been renamed toprograms.river-classicfollowing an upstream decision.services.chatgpt-retrieval-pluginwas removed due to the package having been broken since at least November 2024.services.dwm-status.extraConfigwas replaced by RFC0042-compliantservices.dwm-status.settings, which is used to generate the config file.services.dwm-status.orderis now moved toservices.dwm-status.settings.order, as it’s a part of the config file.services.forgejo.dump.agenow defaults to4w, which deletes dumps older than 4 weeks. This new behaviour could result in older backups being deleted.services.gateonehas been removed as the package was removed such that it does not work.services.journald.gateway.userandservices.journald.gateway.systemnow defaults tofalse. This new behaviour matches the default behaviour of thesystemd-journal-gatewaydservice itself.services.nextcloud.notify_push.enablenow installs the notify_push app. Therefore the appstore is now disabled when usingnotify_push. Seeservices.nextcloud.appstoreEnable.services.nixseparatedebuginfod.enable = true;has been replaced byservices.nixseparatedebuginfod2.enable = true. If you only use the official binary cachehttps://cache.nixos.orgthen no further configuration should be needed. If you have other https substituters, you can add them toservices.nixseparatedebuginfod2.substituters. SSH substituters are not supported by nixseparatedebuginfod2. Consider running nixseparatedebuginfod2 on the substituter instead, and pointing to it with the new optionenvironment.debuginfodServers.services.parsoidand thenodePackages.parsoidpackage have been removed, as the JavaScript-based version this module uses is not compatible with modern MediaWiki versions.services.private-gpthas been removed by lack of maintenance upstream.services.quorumhas been removed as thequorumpackage was broken and abandoned upstream.services.seafilehas been removed, as it is unmaintained and outdated. See the manual for details and next steps.services.tor.torsocks.enableno longer defaults to true if Tor and Tor client functionality is enabled.The
boot.readOnlyNixStorehas been removed. Control over bind mount options on/nix/storeis now offered by theboot.nixStoreMountOptsoption.The
dovecotsystemd service was renamed fromdovecot2todovecot. The former is now just an alias. Update any overrides on the systemd unit to the new name.The
NIXOS_EXTRA_MODULE_PATHvariable from configuration evaluation has been deprecated. We recommend a workflow where you update the expression files instead, but if you wish to continue to use this variable, you may do so with a module like:{ imports = [ (builtins.getEnv "NIXOS_EXTRA_MODULE_PATH") ]; }This has the benefit that your configuration hints at the non-standard workflow.
The
file-rollermodule has been removed due to not being required for function, file roller itself has also been removed from theservices.desktopManager.gnomemodule as it’s not part of GNOME core applications.The Perl implementation of the
switch-to-configurationprogram is removed. All switchable systems now use the Rust rewrite. Any prior usage ofsystem.switch.enableNgmust now be removed. If you have any outstanding issues with the new implementation, please open an issue on GitHub.The Pocket ID module (
services.pocket-id) and package (pocket-id) has been updated to 1.0.0. Some environment variables have been changed or removed, see the migration guide.The Postfix module has been updated and likely requires configuration changes:
The
services.postfix.sslCertandsslKeyoptions were removed and you now need to configureservices.postfix.settings.main.smtpd_tls_chain_files for server certificates,
services.postfix.settings.main.smtp_tls_chain_files for client certificates.
The
services.meilisearchmodule now always defaults to the latest version of meilisearch, as the previousmeilisearch_1_11package was removed. This is only an issue if you were using the old version.The
services.mysqlmodule now restarts the databaseon-abnormal, which means that it now will be restarted in certain situations, it wasn’t before. For example an OOM-kill.The
services.nginx.ssomodule has switched to generating its configuration file in/run. You should manually delete/var/lib/nginx-sso/config.yamlto avoid storing secret values to disk.The
services.postgresqlmodule now sets up a systemd unitpostgresql.target. Depending onpostgresql.targetguarantees that postgres is in read-write mode and initial/ensure scripts were executed. Depending onpostgresql.serviceonly guarantees a read-only connection.The
services.polipomodule has been removed aspolipois unmaintained and archived upstream.The
services.postfixadminmodule has been removed due to a lack of active maintainers.The
services.siproxdmodule has been removed assiproxdis unmaintained and broken with libosip 5.x.The
services.snapservermodule has been migrated to use the settings option and render a configuration file instead of passing every option over the command line.The
services.sourcehutmodule and correspondingsourcehutpackages were removed due to being broken and unmaintained.The
services.traccar.settingsattribute has been reworked. Instead of the previous flat attribute set the new implementation uses nested attribute sets. You need to update you configuration manually. For instance,services.traccar.settings.loggerConsolebecomesservices.traccar.settings.logger.console.The
services.tt-rssmodule and package have been removed as upstream development ceased on 2025-11-01, and the source is no longer available officially.The systemd target
kbrequest.targetis now unset by default, instead of being forcibly symlinked torescue.target. In case you were relying on this behavior (Alt + ArrowUp on the tty causing the current target to be changed torescue.target), you can restore it by settingsystemd.targets.rescue.aliases = [ "kbrequest.target" ];in your configuration.The
wstunnelmodule was converted to RFC42-style settings, you will need to update your NixOS config if you make use of this module.services.xserver.windowManager.yeahwmwas removed due to the package being broken and unmaintained upstream.The zookeeper project changed their logging tool to logback, therefore
services.zookeeper.loggingoption has been updated to expect a logback compatible string.virtualisation.lxdhas been removed due to lack of Nixpkgs maintenance. Users can migrate tovirtualisation.incus, a fork of LXD, as a replacement. See Incus migration documentation for migration information.virtualisation.libvirtdnow uses OVMF images shipped with QEMU for UEFI machines.virtualisation.libvirtd.qemu.ovmfhas been removed.OVMF images from underlying QEMU package are now made available under ‘/run/libvirt/nix-ovmf’, fixing prior issues when using QEMU’s automatic EFI firmware and feature handling, relied upon by GNOME Boxes, virsh, virt-manager, etc.
Domains that rely on automatic firmware and feature handling, i.e.
<os firmware='efi'>need to trigger an update to<loader>and<nvram>entries. Usingvirsh edit <domain>and deleting aforementioned tags will cause libvirt to replace them with the new paths.Configurations that relied on
virtualisation.libvirtd.qemu.ovmfand had domains that did not use automatic firmware and feature handling, require a manual change to their domain configuration, updating<loader>and<nvram>entries from old path to the new path.Old Path New Path /run/libvirt/nix-ovmf/OVMF_CODE.fd /run/libvirt/nix-ovmf/edk2-x86_64-code.fd /run/libvirt/nix-ovmf/OVMF_VARS.fd /run/libvirt/nix-ovmf/edk2-i386-vars.fd /run/libvirt/nix-ovmf/OVMF_CODE.ms.fd /run/libvirt/nix-ovmf/edk2-x86_64-secure-code.fd /run/libvirt/nix-ovmf/OVMF_VARS.ms.fd /run/libvirt/nix-ovmf/edk2-i386-vars.fd /run/libvirt/nix-ovmf/AAVMF_CODE.fd /run/libvirt/nix-ovmf/edk2-aarch64-code.fd /run/libvirt/nix-ovmf/AAVMF_VARS.fd /run/libvirt/nix-ovmf/edk2-arm-vars.fd /run/libvirt/nix-ovmf/AAVMF_CODE.ms.fd /run/libvirt/nix-ovmf/edk2-aarch64-code.fd /run/libvirt/nix-ovmf/AAVMF_VARS.ms.fd /run/libvirt/nix-ovmf/edk2-arm-vars.fd
vmalertnow supports multiple instances with the optionservices.vmalert.instances."".enablevirtualisation.waydroid.packagenow defaults towaydroid-nftableson systems with nftables enabled.services.victorialogs.packagenow defaults tovictorialogs, asvictoriametricsno longer contains the VictoriaLogs binaries.
Other Notable Changes
A new option
boot.isNspawnContainerhas been added. This option will be used to guard nspawn-specific configuration in NixOS sinceboot.isContaineris also used for different container-runtimes such as LXC.The new option is automatically set to
trueby the declarative container module andnixos-containerwhen not using flakes.Existing setups can be migrated by running either
nixos-container update <container-name> --config-file /path/to/the/config-file-in-use.nixnixos-container update <container-name> --config '/* config code */'Setting the option by hand in your configuration when using flakes.
In all other cases, you’ll need to set this option to
trueyourself.boot.isNspawnContainerbeingtrueimpliesboot.isContainerbeingtrue.
amdgpukernel driver overdrive mode can now be enabled by setting hardware.amdgpu.overdrive.enable and customized through hardware.amdgpu.overdrive.ppfeaturemask. This allows for fine-grained control over the GPU’s performance and maybe required by overclocking software like Corectrl and Lact. These new options replace old options such asprograms.corectrl.gpuOverclock.enableandprograms.tuxclocker.enableAMD.bcachefsfile systems will now use the out-of-tree module for supported kernels. The in-tree module has been removed, and users will need to switch to kernels that support the out-of-tree module.boot.plymouthnow has apackageoption to specify the package used in the module.Docker now defaults to 28.x, because version 27.x stopped receiving security updates and bug fixes after May 2, 2025.
Due to deprecation of gnome-session X11 support,
services.desktopManager.pantheonnow defaults to pantheon-wayland session. The X11 session has been removed, see this issue for details.libvirtnow supports usingnftablesbackend.The
virtualisation.libvirtd.firewallBackendoption can be used to configure the firewall backend used by libvirtd.
linux_libre&linux_latest_librehave been removed due to a lack of maintenance.Immich now has support for VectorChord when using the PostgreSQL configuration provided by
services.immich.database.enable, which replacespgvecto-rs. VectorChord support can be toggled with the optionservices.immich.database.enableVectorChord. Additionally,pgvecto-rssupport is now disabled from NixOS 25.11 onwards using the optionservices.immich.database.enableVectors. This option will be removed fully in the future once Immich drops support forpgvecto-rsfully. See Immich migration instructions.It is now possible to configure the default source address using the new options networking.defaultGateway.source, networking.defaultGateway6.source.
mate-wayland-session 1.28.4 is now using the default wayfire decorator instead of firedecor, thus
services.xserver.desktopManager.mate.enableWaylandSessionis no longer shipping firedecor. If you are experiencing broken window decorations after upgrade, backup and remove~/.config/mate/wayfire.iniand re-login.networking.wireless.networks.<name>now has an option to specify SSID, hence allowing duplicated SSID setup. The BSSID option is added alongside with this.Options under networking.getaddrinfo are now allowed to declaratively configure address selection and sorting behavior of
getaddrinfoin dual-stack networks.Potential race conditions in the network setup when using
networking.interfaceshave been fixed by disabling duplicate address detection (DAD) for statically configured IPv6 addresses.prosodygained a config check option namedservices.prosody.checkConfigwhich runsprosodyctl check configand is turned on by default.Revamp of the ACME certificate acquisition and renewal process to help scale systems with lots (100+) of certificates.
Units and targets have been reshaped to better support more specific dependency propagation and avoid superfluously triggering unchanged units:
If a service requires a syntactically valid certificate to start it should now depend on the
acme-{certname}.serviceunit.We now always generate initial self-signed certificates as this drastically simplifies the dependency structure. As a result, the option
security.acme.preliminarySelfsignedhas been removed.Instead of the previous
acme-finished-{certname}.targets there are nowacme-order-renew-{certname}.services that will be activated in a delayed fashion to ensure that bootstrapping with servers like nginx that take part in the acquisition/renewal process works smoothly. Dependencies onacme-finishedunits should move toacme-order-renew.Note that system activation will complete before all certificates may have been renewed or acquired.
services.clamsmtpis unmaintained and was removed from Nixpkgs.services.clickhousehas added theserverConfiganduserConfigoptions. You may also useextraServerConfigandextraUserConfigto pass plain text XML.services.dependency-trackremoved its configuration of the JVM heap size. This lets the JVM choose its maximum heap size automatically, which should work much better in practice for most users. For deployments on systems with little RAM, it may now be necessary to manually configure a maximum heap size usingservices.dependency-track.javaArgs.services.dnscrypt-proxy2was renamed toservices.dnscrypt-proxyto match the package name. The systemd service is now alsodnscrypt-proxy, but the old name is still provided as an alias for backwards compatibility.services.dnscrypt-proxygains apackageoption to specify dnscrypt-proxy package to use.services.eris-serverwas removed from Nixpkgs due to a hostile upstream.services.filesenderand the packagefilesenderhave been removed because they depend onsimplesamlphp.services.giteasupports sending notifications with sendmail again. To do this, activate the parameterservices.gitea.mailerUseSendmailand configure SMTP server.services.gnome.gnome-keyring does not ship with an SSH agent anymore, as this is now handled by the
gcr_4package instead ofgnome-keyring. A new module has been added to support this, underservices.gnome.gcr-ssh-agent.enable(its default value has been set toservices.gnome.gnome-keyring.enableto ensure a smooth transition). See the relevant upstream PR for more details.services.grafanadoes no longer send usage statistics by default.services.k3snow shares most of its code withservices.rke2. The merge resulted in both modules providing more options, withservices.rke2receiving the most improvements. Existing configurations for either module should not be affected.services.libvirtd.autoSnapshot has been added as a backup service for libvirt managed VMs.
services.limesurveynow supports nginx as reverse-proxy. Available as services.limesurvey.webserver.services.mattermosthas been updated to use the 10.11 ESR instead of 10.5. While this shouldn’t break anyone, we also now package Mattermost 11 as mattermostLatest. Note that Mattermost 11 drops support for MySQL. The Mattermost module will assertion fail if you try to use MySQL with Mattermost 11; support for using MySQL with Mattermost will fully be removed in NixOS 26.services.matter-servernow hosts a debug dashboard on the configured port. Open the port on the firewall withservices.matter-server.openFirewall.services.moneronow includes theenvironmentFileoption for adding secrets to the Monero daemon config.services.nebula.networks.<name>will now store configuration files in/etc/nebula/<name>.ymland supports config reloading.services.logind.extraConfigwas converted to RFC42-styleservices.logind.settings.Login.services.nginx.recommendedProxySettingsnow setsX-Forwarded-Serverto the hostname of nginx instead of the original host.services.netbird.servernow uses dedicated packages split out due to relicensing of server components to AGPLv3 with version0.53.0,services.nextcloud.configureRedisnow defaults totruein accordance with upstream recommendations to have caching for file locking. See the upstream doc for further details.services.ntpd-rsnow performs configuration validation.services.opentelemetry-collectorhas a new optionvalidateConfigFileoption that checks the configuration file during build. It is enabled by default if the configuration file is in the Nix store.services.restic.backupsnow includes acommandoption for passing a command to the –stdin-from-command flag.services.pdshas been renamed toservices.bluesky-pds.services.pfix-srsdnow automatically integrates with the local Postfix instance, when enabled. This behavior can disabled using the services.pfix-srsd.configurePostfix option.services.postsrsdnow automatically integrates with the local Postfix instance, when enabled. This behavior can disabled using the services.postsrsd.configurePostfix option.services.varnish.http_addresshas been superseded byservices.varnish.listenwhich is now structured config for all of varnish’s-avariations.services.xserver.desktopManager.deepinand associated packages have been removed due to being unmaintained. See issue #422090 for more details.systemd.extraConfigandboot.initrd.systemd.extraConfigwas converted to RFC42-stylesystemd.settings.Managerandboot.initrd.systemd.settings.Managerrespectively.systemd.watchdog.runtimeTimewas renamed tosystemd.settings.Manager.RuntimeWatchdogSecsystemd.watchdog.devicewas renamed tosystemd.settings.Manager.WatchdogDevicesystemd.watchdog.rebootTimewas renamed tosystemd.settings.Manager.RebootWatchdogSecsystemd.watchdog.kexecTimewas renamed tosystemd.settings.Manager.KExecWatchdogSecsystemd.enableCgroupAccountingwas removed. Cgroup accounting now needs to be disabled directly usingsystemd.settings.Manager.*Accounting.
The
ksycocacache in Plasma 6 will no longer be re-built when$XDG_CACHE_HOMEis not set to$HOME/.cache.The latest available version of Nextcloud is v32 (available as
pkgs.nextcloud32). The installation logic is as follows:If
services.nextcloud.packageis specified explicitly, this package will be installed (recommended)If
system.stateVersionis >=25.05,pkgs.nextcloud32will be installed by default.If
system.stateVersionis >=24.11,pkgs.nextcloud31will be installed by default.nextcloud30is EOL and was thus removed.Please note that an upgrade from v30 (or older) to v32 directly is not possible. Please upgrade to
nextcloud31(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud30;.
The
nettoolspackage (ifconfig, arp, mii-tool, netstat, route) is not installed by default anymore. The suite is unmaintained and users should migrate toiproute2andethtoolinstead.The new option networking.ipips has been added to create IP within IP kind of tunnels (including 4in6, ip6ip6 and ipip). With the existing networking.sits option (6in4), it is now possible to create all combinations of IPv4 and IPv6 encapsulation.
tpm2-totp can now be used to show a TOTP during boot using Plymouth. Available as boot.plymouth.tpm2-totp.
users.users.*.lingernow defaults tonullrather thanfalse, meaning NixOS will not attempt to enable or disable lingering for that user account, instead allowing for imperative control over lingering using theloginctlcommands. In practice, this is unlikely to make a difference for most people, as new users are created without lingering configured. There is a new, related option,users.manageLingering, which can be used to prevent NixOS attempting to manage lingering entirely.
Release 25.05 (“Warbler”, 2025.05/23)
Highlights
Alongside many enhancements to NixOS modules and general system improvements, this release features the following highlights:
NixOS now has initial support for the COSMIC DE which is currently at Alpha 7. COSMIC is a Rust-based Desktop Environment by System76, makers of Pop!_OS. You can use COSMIC by enabling the greeter (login manager) with
services.displayManager.cosmic-greeter.enable, and the DE itself by enablingservices.desktopManager.cosmic.enable. The support in NixOS/Nixpkgs is stable but still considered experimental because of the recent the addition. The COSMIC maintainers will be waiting for one more release of NixOS to determine if the experimental tag should be removed or not. Until then, please report any issues to the COSMIC DE tracker in Nixpkgs instead of upstream.nixos-rebuild-ng, a full rewrite ofnixos-rebuildin Python, is available for testing. You can enable it by settingsystem.rebuild.enableNgin your configuration (this will replace the oldnixos-rebuild), or by addingnixos-rebuild-ngto yourenvironment.systemPackages(in this case, it will live side-by-side withnixos-rebuildasnixos-rebuild-ng). It is expected that the next major version of NixOS (25.11) will enablesystem.rebuild.enableNgby default.A
nixos-rebuild build-imagesub-command has been added. It allows users to build platform-specific (disk) images from their NixOS configurations.nixos-rebuild build-imageworks similar to the popular nix-community/nixos-generators project. See new section on image building in the NixOS manual. It is also available fornixos-rebuild-ng.nixos-optionhas been rewritten to a Nix expression called by a simple bash script. This lowers our maintenance threshold, makes eval errors less verbose, adds support for flake-based configurations, descending intoattrsOfandlistOfsubmodule options, and--show-trace.The global Mesa version can now be managed without a mass rebuild by setting
hardware.graphics.package.GNOME has been updated to version 48.
decibelsmusic player is now installed by default. You can disable it usingenvironment.gnome.excludePackages.gnome-shell-extensionsextension collection (which included GNOME Classic extensions, Apps Menu, and User Themes, among others) are no longer installed by default. You can install them again withservices.xserver.desktopManager.gnome.sessionPath.Option
services.gnome.core-developer-tools.enablenow also installssysprofandd-spy.Option
services.gnome.core-utilities.enablehas been renamed toservices.gnome.core-apps.enable.cantarell-fonts,source-code-proandsource-sansfonts are no longer installed by default. They have been replaced byadwaita-fonts.
Refer to the GNOME release notes for more details.
channels.nixos.org now supports the Lockable HTTP Tarball Protocol. This allows using the channel
nixexprs.taras Nix Flake input, e.g.:inputs.nixpkgs.url = "https://channels.nixos.org/nixos-25.05/nixexprs.tar.xz";
New Modules
AmneziaVPN, a self-hostable open-source VPN client, is available in two variants:
programs.amnezia-vpn: a GUI client which can also deploy a VPN endpoint to a remote server
networking.wireguardadds support for the AmneziaWG variant of the protocol, featuring better masking against Deep Packet Inspection. The variant to be used is set per interface asnetworking.wireguard.interfaces.<name>.type, defaulting to wireguard.
Bazecor, the graphical configurator for Dygma Products. Available as programs.bazecor.
Bonsai, a general-purpose event mapper/state machine primarily used to create complex key shortcuts, and as part of the SXMO desktop environment. Available as services.bonsaid.
scanservjs, a web UI for SANE scanners. Available at services.scanservjs.
Kimai, a web-based multi-user time-tracking application. Available as services.kimai.
Kismet, a Wi-Fi, Bluetooth, and RF monitoring application supporting a wide range of hardware. Available as services.kismet.
vwifi, a Wi-Fi simulator daemon leveraging the
mac80211_hwsimandvhost_vsockkernel modules for efficient simulation of multi-node Wi-Fi networks. Available as services.vwifi.Oncall, a web-based calendar tool designed for scheduling and managing on-call shifts. Available as services.oncall.
Homer, a very simple static homepage for your server. Available as services.homer.
Ghidra, a software reverse engineering (SRE) suite of tools. Available as programs.ghidra.
Omnom, a webpage bookmarking and snapshotting service. Available as services.omnom.
Yggdrasil-Jumper, an independent project that aims to transparently reduce latency of a connection over Yggdrasil network, utilizing NAT traversal to automatically bypass intermediary nodes. Available as services.yggdrasil-jumper.
xpad-noone is the original upstream xpad driver from the Linux kernel with support for Xbox One controllers removed — especially useful for people who want to use an XBox One controller under the
xonedriver and an Xbox 360 controller under thexpaddriver at the same time. Available as hardware.xpad-noone.uMurmur, minimalistic Mumble server primarily targeted to run on embedded computers. Available as services.umurmur.
Zenoh, a pub/sub/query protocol with low overhead. The Zenoh router daemon is available as services.zenohd.
ytdl-sub, a tool that downloads media via yt-dlp and prepares it for your favorite media player, including Kodi, Jellyfin, Plex, Emby, and modern music players. Available as services.ytdl-sub.
MaryTTS, an open-source, multilingual text-to-speech synthesis system written in pure Java. Available as services.marytts.
Continuwuity, a federated chat server implementing the Matrix protocol, forked from Conduwuit. Available as services.matrix-continuwuity.
Reposilite, a lightweight and easy-to-use repository manager for Maven-based artifacts in the JVM ecosystem. Available as services.reposilite.
networking.modemmanager has been split out of networking.networkmanager. NetworkManager still enables ModemManager by default, but options exist now to run NetworkManager without ModemManager.
Routinator 3000, a full-featured RPKI Relying Party software package that runs as a service which periodically downloads and verifies RPKI data. Available as services.routinator.
doh-server, a high performance DNS over HTTPS server. Available as services.doh-server.
ncps, a Nix binary cache proxy service implemented in Go using go-nix. Available as services.ncps.
Readeck, a read-it later web-application. Available as services.readeck.
EasyTier, a decentralized VPN solution. Available as services.easytier.
Traccar, a modern GPS Tracking Platform. Available as services.traccar.
Memos, a privacy-first, lightweight note-taking solution that allows you to effortlessly capture and share your ideas. Available as services.memos.
Schroot, a lightweight virtualisation tool. Securely enter a chroot and run a command or login shell. Available as programs.schroot.
Firezone, an enterprise-ready zero-trust access platform built on WireGuard. This includes the server stack as services.firezone.server.enable, a TURN/STUN relay service as services.firezone.relay.enable, a gateway service as services.firezone.gateway.enable, a headless client as services.firezone.headless-client.enable and a GUI client as services.firezone.gui-client.enable.
crab-hole, a cross platform Pi-hole clone written in Rust using hickory-dns/trust-dns. Available as services.crab-hole.
agnos, a program that obtains TLS certificates from an ACME provider via the DNS-01 challenge without using third-party DNS provider APIs. Available as security.agnos.
zwave-js-ui, a full featured Z-Wave Control Panel and MQTT Gateway. Available as services.zwave-js-ui.
Pinchflat, a selfhosted YouTube media manager used to track channels and download videos on release. Available as services.pinchflat.
Amazon CloudWatch Agent, the official telemetry collector for AWS CloudWatch and AWS X-Ray. Available as services.amazon-cloudwatch-agent.
Fluent Bit, a fast Log, Metrics and Traces Processor and Forwarder. Available as services.fluent-bit.
Bat, a cat(1) clone with wings. Available as programs.bat.
Autotier, a passthrough FUSE filesystem. Available as services.autotierfs.
PostgREST, a standalone web server that turns your PostgreSQL database directly into a RESTful API. Available as services.postgrest.
postgres-websockets, a middleware that adds websockets capabilities on top of PostgreSQL’s asynchronous notifications using LISTEN and NOTIFY commands. Available as services.postgres-websockets.
µStreamer, a lightweight MJPEG-HTTP streamer. Available as services.ustreamer.
Whoogle Search, a self-hosted, ad-free, privacy-respecting metasearch engine. Available as services.whoogle-search.
autobrr, a modern download automation tool for torrents and usenets. Available as services.autobrr.
cross-seed, a tool to set-up fully automatic cross-seeding of torrents. Available as services.cross-seed.
Froide-Govplan, a web application government planer. Available as services.froide-govplan.
agorakit, an organization tool for citizens’ collectives. Available with services.agorakit.
vivid, a generator for
LS_COLOR. Available as programs.vivid.matrix-alertmanager, a bot to receive Alertmanager webhook events and forward them to chosen Matrix rooms. Available as services.matrix-alertmanager.
waagent, the Microsoft Azure Linux Agent (waagent) manages Linux provisioning and VM interaction with the Azure Fabric Controller. Available with services.waagent.
nfc-nci, an alternative NFC stack and PC/SC driver for the NXP PN54x chipset, commonly found in Lenovo systems as NXP1001 (NPC300). Available as hardware.nfc-nci.
grav, a modern flat-file CMS. Available with services.grav.
duckdns, free dynamic DNS. Available with services.duckdns.
Zoxide, a smarter cd command, inspired by z and autojump. Available as programs.zoxide.
victorialogs, log database from VictoriaMetrics. Available as services.victorialogs.
gokapi, Lightweight selfhosted Firefox Send alternative without public upload. AWS S3 supported. Available with services.gokapi.
nostr-rs-relay, This is a nostr relay, written in Rust. Available as services.nostr-rs-relay.
haven, is a high availability vault for events on nostr. Available as services.haven.
strfry, a relay for the nostr protocol. Available as services.strfry.
Prometheus Node Cert Exporter, a prometheus exporter to check for SSL cert expiry. Available as services.prometheus.exporters.node-cert.
Actual Budget, a local-first personal finance app. Available as services.actual.
immich-public-proxy, a proxy for sharing Immich albums without exposing the Immich API. Available as services.immich-public-proxy.
Zipline, a ShareX/file upload server that is easy to use, packed with features, and with an easy setup. Available as services.zipline.
GlitchTip, an open source Sentry API compatible error tracking platform. Available as services.glitchtip.
yarr, a small, web-based feed aggregator and RSS reader. Available as services.yarr.OliveTin, gives safe and simple access to predefined shell commands from a web interface. Available as services.olivetin.
alertmanager-ntfy, forwards Prometheus Alertmanager notifications to ntfy.sh. Available as services.prometheus.alertmanager-ntfy.
Stash, an organizer for your adult videos/images, written in Go. Available as services.stash.
vsmartcard-vpcd, a virtual smart card driver. Available as services.vsmartcard-vpcd.
Fider, an open platform to collect and prioritize feedback. Available as services.fider.
PDS, Personal Data Server for bsky. Available as
services.pds.Anubis, a scraper defense software. Available as services.anubis.
synapse-auto-compressor, a rust-based matrix-synapse state compressor for postgresql. Available as services.synapse-auto-compressor.
mqtt-exporter, a Prometheus exporter for exposing messages from MQTT. Available as services.prometheus.exporters.mqtt.
pocket-id, an OIDC provider with passkeys support. Available as services.pocket-id.
nvidia-gpu, a Prometheus exporter that scrapes
nvidia-smifor GPU metrics. Available as services.prometheus.exporters.nvidia-gpu.Lavalink, a standalone audio sending node based on Lavaplayer and Koe. Available as services.lavalink.
OpenGamepadUI, an open source gamepad-native game launcher and overlay for Linux. Available as programs.opengamepadui.
InputPlumber, an open source input router and remapper daemon for Linux. Available as services.inputplumber.
dump1090-fa, a simple Mode S decoder for RTLSDR devices with a web interface. Available as services.dump1090-fa.PowerStation, an open source TDP control and performance daemon with DBus interface for Linux. Available as services.powerstation.
g3proxy, an open source enterprise forward proxy from ByteDance, similar to Squid or tinyproxy. Available as services.g3proxy.OpenCloud, an open-source, modern file-sync and sharing platform. It is a fork of oCIS, a ground-up rewrite of the well-known PHP-based NextCloud server. Available as services.opencloud.
echoip, a simple service for looking up your IP address. Available as services.echoip.
whoami, a tiny Go server that prints OS information and HTTP request to output. Available as services.whoami.
LiteLLM, a LLM Gateway to provide model access, fallbacks and spend tracking across 100+ LLMs. All in the OpenAI format. Available as services.litellm.
Buffyboard, a framebuffer on-screen keyboard. Available as services.buffyboard.
KanBoard, a project management tool that focuses on the Kanban methodology. Available as services.kanboard.
git-worktree-switcher, switch between git worktrees with speed. Available as programs.git-worktree-switcher.
GLPI-Agent, GLPI Agent. Available as services.glpiAgent.
pgBackRest, a reliable backup and restore solution for PostgreSQL. Available as services.pgbackrest.
Recyclarr a TRaSH Guides synchronizer for Sonarr and Radarr. Available as services.recyclarr.
Rebuilderd an independent verification of binary packages - Reproducible Builds. Available as services.rebuilderd.
Limine a modern, advanced, portable, multiprotocol bootloader and boot manager. Available as boot.loader.limine.
tee-supplicant, a userspace supplicant for OP-TEE OS. Available as services.tee-supplicant.
Orthanc a lightweight, RESTful DICOM server for healthcare and medical research. Available as services.orthanc.
Docling Serve running Docling as an API service. Available as services.docling-serve.
Pareto Security is an alternative to corporate compliance solutions for companies that care about security but know it doesn’t have to be invasive. Available as services.paretosecurity.
GNU Rush is a Restricted User Shell, designed for systems providing limited remote access to their resources. Available as programs.rush.
ipfs-cluster, Pinset orchestration for IPFS. Available as services.ipfs-cluster.
bitbox-bridge, a bridge software that connects BitBox hardware wallets to computers & web wallets like Rabby. Allows one to interact & transact with smart contracts, Web3 websites & financial services without storing private keys anywhere other than the hardware wallet. Available as services.bitbox-bridge.
GoDNS, a dynamic DNS client written in Go, which supports multiple DNS providers. Available as services.godns.
CookCLI Server, a web UI for cooklang recipes. Available as services.cook-cli.
Prometheus eBPF Exporter, Prometheus exporter for custom eBPF metrics. Available as services.prometheus.exporters.ebpf.
Backward Incompatibilities
services.rippledhas been removed, asrippledwas broken and had not been updated since 2022.services.rippleDataApihas been removed, asripple-data-apiwas broken and had not been updated since 2022.The
nixos/modules/virtualisation/amazon-ec2-amis.nixfile is not supported anymore since 24.05. It will throw and error starting 25.05 with instructions the following instructions: The canonical source for NixOS AMIs is the AWS API. Please see https://nixos.org/download/#nixos-amazon or https://nixos.github.io/amis/ for instructions.The latest available version of Nextcloud is v31 (available as
pkgs.nextcloud31). The installation logic is as follows:If
services.nextcloud.packageis specified explicitly, this package will be installed (recommended)If
system.stateVersionis >=24.11,pkgs.nextcloud30will be installed by default.If
system.stateVersionis >=24.05,pkgs.nextcloud31will be installed by default.Please note that an upgrade from v29 (or older) to v31 directly is not possible. Please upgrade to
nextcloud30(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud30;.
services.cloudflare-dyndns.apiTokenFilenow must be just your Cloudflare api token. Previously it was supposed to be a file of the formCLOUDFLARE_API_TOKEN=....services.nextcloud.config.dbtypeis unset by default, the previous default wassqlite. This was done becausesqliteis not a reasonable default since it’s not recommended by upstream and thus doesn’t qualify as default.PowerDNS Recursor has been updated to version 5.1.2, which comes with a new YAML configuration format (
recursor.yml) and deprecates the previous format (recursor.conf). Accordingly, the NixOS optionservices.pdns-recursor.settingshas been renamed toold-settingsand will be provided for backward compatibility until the next NixOS release. Users are asked to migrate their settings to the newyaml-settings. option following this guide. Note that options other thanservices.pdns-recursor.settingsare unaffacted by this change.The
virtualisation.hypervGuest.videoModeoption has been removed. Standard tooling can now be used to configure display modes for Hyper-V VMs.Nextcloud’s default FPM pool settings have been increased according to upstream recommendations. It’s advised to review the new defaults and description of
services.nextcloud.poolSettings.In
users.userssubuid allocation on systems with multiple users it could happen that some users’ allocated subuid ranges collided with others. Now these users get new subuid ranges assigned. When this happens, a warning is issued on the first activation. If the subuids were used (e.g. with rootless container managers like podman), please change the ownership of affected files accordingly.The
services.locatemodule does no longer support findutil’slocatedue to its inferior performance compared tomlocateandplocate. The new default isplocate. As theservice.locate.localuseroption only applied when using findutil’slocate, it has also been removed.services.paperlessnow installspaperless-manageas a normal system package instead of creating a symlink in/var/lib/paperless.paperless-managenow also changes to the appropriate user when being executed.asusdhas been upgraded to version 6 which supports multiple aura devices. To account for this, the singleauraConfigconfiguration option has been replaced withauraConfigswhich is an attribute set of config options per each device. The config files may also be now specified as either source files or text strings; to account for this you will need to specify thattextis used for your existing configs, e.g.:-services.asusd.asusdConfig = '''file contents''' +services.asusd.asusdConfig.text = '''file contents'''linuxPackages.nvidiaPackages.stablenow defaults to theproductionvariant instead oflatest.services.paperless.addressno longer accepts a domain name or Unix domain socket.networking.wireguard.enable = truedoes not always addwireguard-toolsto system packages anymore. Only when wireguard interfaces are configured, the backing implementation packages are added to system PATH.virtualisation/azure-common.nix’s filesystem and grub configurations have been moved tovirtualisation/azure-image.nix. This makesazure-common.nixmore generic so it could be used for users who generate Azure image using other methods (e.g. nixos-generators and disko). For existing users depending on these configurations, please also importazure-image.nix.services.signaldhas been removed assignaldis unmaintained upstream and has been incompatible to official Signal servers for a long while.The
earlyoomservice is now using upstream systemd service, which enables hardening and filesystem isolation by default. If you need filesystem write access or want to access home directory viakillHook, hardening setting can be changed via, e.g.systemd.services.earlyoom.serviceConfig.ProtectSystem.services.earlyoom.extraArgsis now shell-escaped for each element without word-breaking. So you want to writeextraArgs = [ "--prefer" "spaced pat" ]rather than previousextraArgs = [ "--prefer 'spaced pat'" ].programs.less.lessopenis now null by default. To restore the previous behaviour, set it to''|${lib.getExe' pkgs.lesspipe "lesspipe.sh"} %s''.hardware.pulseaudiohas been renamed toservices.pulseaudio. The deprecated option names will continue to work, but causes a warning.services.nextcloudnow uses systemd’s credential mechanism to read in secret files. Thenextcloud-occwrapper script implements this usingsystemd-run, as such it now also requires root privileges or$CREDENTIALS_DIRECTORYset where running it as usernextcloudwas enough previously.services.mongodb.initialRootPasswordhas been replaced with the more secure optionservices.mongodb.initialRootPasswordFileservices.bird2has been renamed toservices.birdand the default bird package has been switched tobird3.bird2can still be chosen via theservices.bird.packageoption.The behavior of the
networking.nat.externalIPandnetworking.nat.externalIPv6options has been changed.networking.nat.forwardPortsnow only forwards packets destined for the specified IP addresses.gitlabhas been updated from 17.x to 18.x and requirespostgresql>= 16, as stated in the documentation. Check the upgrade guide in the NixOS manual on how to upgrade your PostgreSQL installation.services.gitlabnow requires the setting ofactiveRecordPrimaryKeyFile,activeRecordDeterministicKeyFile,activeRecordSaltFileas GitLab introduced Rails ActiveRecord encryption.The Mattermost module (
services.mattermost) and packages (mattermostandmmctl) have been substantially updated:services.mattermost.listenAddresshas been split intoservices.mattermost.hostandservices.mattermost.port. If yourlistenAddresscontained a port, you will need to edit your configuration. This will be the only truly breaking change in this release for most configurations.services.mattermost.preferNixConfignow defaults to true if you advancesystem.stateVersionto 25.05. This means that if you haveservices.mattermost.mutableConfigset, NixOS will override settings set in the Admin Console to those that you define in the module configuration. It is recommended to leave this at the default, even if you used a fully mutable configuration before, because it will ensure that your Mattermost data directories are correct. If you moved your data directories, you may want to review the module changes before upgrading.Mattermost now supports peer authentication on both MySQL and Postgres database backends. Updating
system.stateVersionto 25.05 or later will result in peer authentication being used by default if the Mattermost server would otherwise be connecting to localhost. This is the recommended configuration.Note that the Mattermost module will create an account without a well-known UID if the username differs from the default (
mattermost). If you used Mattermost with a nonstandard username, you may want to review the module changes before upgrading.
DokuWiki with the Caddy webserver (
services.dokuwiki.webserver = "caddy") now sets up sites with Caddy’s automatic HTTPS instead of HTTP-only. To keep the old behavior for a siteexample.com, setservices.caddy.virtualHosts."example.com".hostName = "http://example.com". If you set custom Caddy options for a DokuWiki site, migrate these options by removinghttp://fromservices.caddy.virtualHosts."http://example.com".Wordpress with the Caddy webserver (
services.wordpress.webserver = "caddy") now sets up sites with Caddy’s automatic HTTPS instead of HTTP-only. Given a site example.com, http://example.com now 301 redirects to https://example.com. To keep the old behavior for a siteexample.com, setservices.caddy.virtualHosts."example.com".hostName = "http://example.com".The behavior of
services.hostapd.radios.<name>.networks.<name>.authentication.enableRecommendedPairwiseCipherswas changed to not includeCCMP-256anymore. Since all configured pairwise ciphers have to be supported by the radio, this caused startup failures on many devices which is hard to debug in hostapd.The
hardware.gkrakenmodule has been removed. The recommended alternative isprograms.coolercontrol.To avoid delaying user logins unnecessarily the
multi-user.targetis no longer ordered afternetwork-online.target. System services requiring a connection to start correctly must explicitly state so, i.e.{ systemd.services."<name>" = { wants = [ "network-online.target" ]; after = [ "network-online.target" ]; }; }This changed follows a deprecation period of one year started in NixOS 24.05 (see PR #283818).
The values of
services.borgbackup.jobs.*.extraArgsand otherextra*Argsoptions are now represented as Bash arrays. If these arguments were modified usingservices.borgbackup.jobs.*.preHook, they will need to be adjusted to append to these arrays, i.e.-extraCreateArgs="$extraCreateArgs --exclude /some/path" +extraCreateArgs+=("--exclude" "/some/path")programs.xonsh.packagenow gets overridden internally withextraPackagesto supportprograms.xonsh.extraPackages. Seeprograms.xonsh.extraPackagesfor more details.services.nitter.guestAccountshas been renamed toservices.nitter.sessionsFile, for consistency with upstream. The file format is unchanged.virtualisation.azure.agentoption provided byazure-agent.nixis replaced byservices.waagent, and will be removed in a future release.Netdata removed support for non cloud deployments in version 2, so the
withCloudoption has been removed.The ZFS import service now respects
fileSystems.*.options = [ "noauto" ];and does not add that pool’s import service tozfs-import.target, meaning it will not be automatically imported at boot.Default file names of images generated by several builders in
system.buildhave been changed as outlined in the table below.Names are now known at evaluation time and customizable via the new options
image.baseName,image.extension,image.fileNameandimage.filePathwith the latter returning a path relative to the derivations out path (e.g.iso/${image.fileNamefor iso images).system.buildOptionOld Filename New Filename amazonImage nixos-amazon-image-25.05pre-git-x86_64-linux.vhd nixos-image-amazon-25.05pre-git-x86_64-linux.vhd azureImage disk.vhd nixos-image-azure-25.05pre-git-x86_64-linux.vhd digitalOceanImage nixos.qcow2.gz nixos-image-digital-ocean-25.05pre-git-x86_64-linux.qcow2.gz googleComputeImage nixos-image-25.05pre-git-x86_64-linux.raw.tar.gz nixos-image-google-compute-25.05pre-git-x86_64-linux.raw.tar.gz hypervImage nixos-25.05pre-git-x86_64-linux.vhdx nixos-image-hyperv-25.05pre-git-x86_64-linux.vhdx isoImage (installer) nixos-25.05pre-git-x86_64-linux.iso nixos-image-25.05pre-git-x86_64-linux.iso isoImage nixos.iso nixos-image-25.05pre-git-x86_64-linux.iso kubevirtImage nixos.qcow2 nixos-image-kubevirt-25.05pre-git-x86_64-linux.qcow2 linodeImage nixos-image-25.05pre-git-x86_64-linux.img.gz nixos-image-linode-25.05pre-git-x86_64-linux.img.gz metadata (lxc-container) nixos-system-x86_64-linux.tar.xz nixos-image-lxc-metadata-25.05pre-git-x86_64-linux.tar.xz OCIImage nixos.qcow2 nixos-image-oci-25.05pre-git-x86_64-linux.qcow2 openstackImage (zfs) nixos-openstack-image-25.05pre-git-x86_64-linux.root.qcow2 nixos-image-openstack-zfs-25.05pre-git-x86_64-linux.root.qcow2 openstackImage nixos.qcow2 nixos-image-openstack-25.05pre-git-x86_64-linux.qcow2 sdImage nixos-sd-image-25.05pre-git-x86_64-linux.img.zst nixos-image-sd-card-25.05pre-git-x86_64-linux.img.zst tarball (lxc-container) nixos-system-x86_64-linux.tar.xz nixos-image-lxc-25.05pre-git-x86_64-linux.tar.xz tarball (proxmox-lxc) nixos-system-x86_64-linux.tar.xz nixos-image-lxc-proxmox-25.05pre-git-x86_64-linux.tar.xz vagrantVirtualbox nixos-25.05pre-git-x86_64-linux.ova nixos-image-virtualbox-25.05pre-git-x86_64-linux.ova virtualBoxOVA virtualbox-vagrant.box nixos-image-vagrant-virtualbox-25.05pre-git-x86_64-linux.ova vmwareImage nixos-25.05pre-git-x86_64-linux.vmdk nixos-image-vmware-25.05pre-git-x86_64-linux.vmdk security.apparmor.policies.<name>.enforceandsecurity.apparmor.policies.<name>.enablewere removed. Configuring the state of apparmor policies must now be done usingsecurity.apparmor.policies.<name>.statetristate option.services.graylog.packagenow defaults tograylog-6_0as previous defaultgraylog-5_1is EOL and therefore removed. Check the migration guides on 5.1→5.2 and 5.2→6.0 for breaking changes.programs.clash-verge.tunModewas deprecated and removed because now service mode is necessary to start program. Withoutprograms.clash-verge.enable, clash-verge-rev will refuse to start.services.discoursenow requires PostgreSQL 15 per default. Please update before upgrading.services.homepage-dashboardnow requires theallowedHostsoption to be set in accordance with the documentation.luakithas been updated to 2.4.0. If you use any website which uses IndexedDB or local storage and wish to retain the saved information, some manual intervention may be requiredservices.netbird.tunnelswas renamed toservices.netbird.clients, hardened (using dedicated less-privileged users) and significantly extended.services.rsyncd.settingsnow supports only two attributessectionsandglobalSection. As a result, all sections previously defined underservices.rsyncd.settingsmust now be put inservices.rsyncd.settings.sections. Global settings must now be placed inservices.rsyncd.settings.globalSectioninstead ofservices.rsyncd.settings.global.
Other Notable Changes
virtualisation.containerswith backend “podman” now supports rootless containers andsd_notify(3)-integration based on container healthchecks.Cinnamon has been updated to 6.4, please check the upstream announcement for more details.
Following changes in Mint 22 we are no longer overriding Qt application styles. You can still restore the previous default with
qt.style = "gtk2"andqt.platformTheme = "gtk2".Following changes in Mint 20 we are replacing xplayer with celluloid since xplayer is no longer maintained.
Pantheon has been updated to 8, please check the upstream announcement for more details.
Same as elementary OS, the X11 session is named “Classic Session” and the Wayland session is named “Secure Session”.
The dock has been rewritten, you need to manually migrate the dock items on update. You can check
~/.config/plank/dock1/launchers/for your previous settings.
Xfce has been updated to 4.20, please check the upstream feature tour for more details.
Wayland session is still experimental and requires opt-in using
enableWaylandSessionoption.Overriding Wayland compositor is possible using
waylandSessionCompositoroption, but you might need to take carexfce4-session,dbus-update-activation-environmentandsystemctl --user import-environmenton startup.For new Xfce installations, default panel layout has changed to not include external panel plugins by default. You can still add them yourself using the “Panel Preferences” dialog.
PAM services for
i3lock/i3lock-color,vlock,xlock, andxscreensavernow default to disabled unless other corresponding NixOS options are set (programs.i3lock.enable,console.enable,services.xserver.enable, andservices.xscreensaver.enable, respectively). If for some reason you want one of them back without setting the corresponding option, set, e.g.,security.pam.services.xlock.enable = true.The
nixos-generate-configcommand now supports a optional--flakeoption, which will generate a flake.nix file alongside theconfiguration.nixandhardware-configuration.nix, providing an easy introduction into flake-based system configurations.system.stateVersionis now validated and must be in the"YY.MM"format, ideally corresponding to a prior NixOS release.hardware.xonewill also enablehardware.xpad-nooneto provide Xbox 360 driver by default.services.mysqlnow supports easy cluster setup viaservices.mysql.galeraClusteroption.Example:
{ services.mysql = { enable = true; galeraCluster = { enable = true; localName = "Node 1"; localAddress = "galera_01"; nodeAddresses = [ "galera_01" "galera_02" "galera_03" ]; }; }; }systemd’s systemd-ssh-generator(8) now works out of the box on NixOS.
You can ssh into VMs without any networking configuration if your hypervisor configures the vm to support AF_VSOCK. It still requires the usual ssh authentication methods.
An SSH key for the root user can be provisioned using the
ssh.authorized_keys.rootsystemd credential. This can be useful for booting an installation image and providing the SSH key with an smbios string.SSH can be used for suid-less privilege escalation on the local system without having to rely on networking:
ssh root@.hostsystemd’s systemd-ssh-proxy(1) is enabled by default. It can be disabled using
programs.ssh.systemd-ssh-proxy.enable.
SSH host key generation has been separated into the dedicated systemd service sshd-keygen.service.
services.dexnow restarts upon changes to the.environmentFileoption orpathtype entries in.settings.staticClients[].secretFile.services.geoclue2now has anenableStaticoption, which allows the NixOS configuration to specify a fixed location for GeoClue to use.services.mongodbis now compatible with themongodb-cebinary package. To make use of it, setservices.mongodb.packagetopkgs.mongodb-ce.services.jupyteris now compatible withJupyter Notebook 7. See the migration guide for details.networking.wireguardnow has an optional networkd backend. It is enabled by default whennetworking.useNetworkdis enabled, and it can be enabled alongside scripted networking withnetworking.wireguard.useNetworkd. Somenetworking.wireguardoptions have slightly different behavior with the networkd and script-based backends, documented in each option.services.rss-bridgenow has apackageoption as well as support forcaddyas reverse proxy.services.avahi.ipv6now defaults to true.In the
services.xserver.displayManager.startxmodule, two new options generateScript and extraCommands have been added to to declaratively configure the .xinitrc script.All services that require a root certificate bundle now use the value of a new read-only option,
security.pki.caBundle.services.hddfancontrolhas been modified to use an attribute set for settings, enabling configurations with multiple instances of the daemon running at once (e.g., for two separate drive bays).services.cloudflarednow uses a dynamic user, and itsuserandgroupoptions have been removed. If the user or group is still necessary, they can be created manually.The Home Assistant module has new options
services.home-assistant.blueprints.automation,services.home-assistant.blueprints.script, andservices.home-assistant.blueprints.templatethat allow for the declarative installation of blueprints into the appropriate configuration directories.services.dovecot2.moduleshave been removed, now need to useenvironment.systemPackagesto load additional Dovecot modules.services.kmonadnow creates a determinate symlink (in/dev/input/by-id/) to each of KMonad virtual devices.services.searxnow supports configuration of the favicons cache and other options available in SearXNG’sfavicons.tomlfileservices.giteanow supports CAPTCHA usage through theservices.gitea.captchavariable.services.soft-servenow restarts upon config change.services.keycloaknow provides arealmFilesoption that allows to import realms during startup. See https://www.keycloak.org/server/importExportbind.cacheNetworksnow only controls access for recursive queries, where it previously controlled access for all queries.The Starship module now automatically loads the starship prompt when using
xonsh.services.mongodb.enableAuthnow uses the newer mongosh shell instead of the legacy shell to configure the initial superuser. You can configure the mongosh package to use through theservices.mongodb.mongoshPackageoption.There is a new set of NixOS test tools for testing virtual Wi-Fi networks in many different topologies. See the
services.vwifimodule,services.kismetNixOS test, and manual for documentation and examples.The paperless module now has an option for regular automatic export of documents data using the integrated document exporter.
Exposed the
paperless-managescript package via theservices.paperless.manageread-only option.New options for the declarative configuration of the user space part of ALSA have been introduced under hardware.alsa, including setting the default capture and playback device, defining sound card aliases and volume controls. Note: these are intended for users not running a sound server like PulseAudio or PipeWire, but having ALSA as their only sound system.
services.k3snow provides theautoDeployChartsoption that allows to automatically deploy Helm charts via the k3s Helm controller.Mattermost, a self-hosted chat collaboration platform supporting calls, playbooks, and boards, has been updated. It now has multiple versions, disabled telemetry, and a native frontend build in nixpkgs, removing all upstream prebuilt blobs.
Mattermost telemetry reporting is now disabled by default, though security update notifications are enabled. Look at
services.mattermost.telemetryfor options to control this behavior.The Mattermost module will produce eval warnings if a database password would end up in the Nix store, and recommend alternatives such as peer authentication or using the environment file.
We now support
mmctlfor Mattermost administration if bothservices.mattermost.socket.enableandservices.mattermost.socket.exportare set, which export the Mattermost control socket path into the system environment.
services.geoclue2now uses beaconDB as a default geolocation service, replacing Mozilla Location Services which was retired in June 2024.security.acmenow supports renewal using CSRs (Certificate Signing Request) through the optionssecurity.acme.*.csrandsecurity.acme.*.csrKey.programs.fzf.keybindingsnow supports the fish shell.A toggle has been added under
users.users.<name>.enableto allow toggling individual users conditionally. If set to false, the user account will not be created.New hooks were added:
writableTmpDirAsHomeHook: This setup hook ensures that the directory specified by theHOMEenvironment variable is writable.addBinToPathHook: This setup hook checks if thebin/directory exists in the$outoutput path and, if so, adds it to thePATHenvironment variable.gitSetupHook: This setup hook sets up a valid Git configuration, including theuser.nameanduser.emailfields.
NixOS Wiki
The official NixOS Wiki at wiki.nixos.org has new and improved articles, new contributors and some improvements in its dark theme and mobile readability.
Nixpkgs 25.05 (2025.05/23)
Highlights
This release of Nixpkgs requires macOS Big Sur 11.3 or newer, as announced in the 24.11 release notes. We cannot guarantee that packages will continue to work on older versions of macOS. Future Nixpkgs releases will only support macOS versions supported by Apple; this means that Nixpkgs 25.11 will require macOS Sonoma 14 or newer. Users on old macOS versions should consider upgrading to a supported version (potentially using OpenCore Legacy Patcher for old hardware) or installing NixOS. If neither of those options are viable and you require new versions of software, MacPorts supports versions back to Mac OS X Snow Leopard 10.6.
The default kernel package has been updated from 6.6 to 6.12. All supported kernels remain available.
GCC has been updated from GCC 13 to GCC 14. This introduces some backwards‐incompatible changes; see the upstream porting guide for details.
The default GHC version has been updated from 9.6 to 9.8.
haskellPackagesalso uses Stackage LTS 23 (instead of LTS 22) as a baseline. We aim to remove the old GHC versions 8.10, 9.0 and 9.2 in the next release in accordance with the new GHC deprecation policy.LLVM has been updated from LLVM 16 (on Darwin) and LLVM 18 (on other platforms) to LLVM 19. This introduces some backwards‐incompatible changes; see the upstream release notes for details.
The Factor programming language packages were reworked.
factor-lang-scopeis now namedfactorPackagesand provides abuildFactorApplicationfunction to deploy Factor programs as binaries. It has also received proper documentation in the Nixpkgs manual.The packaging of Mesa graphics drivers has been significantly reworked, in particular:
Applications linked against different Mesa versions than installed on the system should now work correctly going forward (however, applications against older Mesa, e.g. from Nixpkgs releases before 25.05, remain broken)
Packages that used to depend on Mesa for libgbm or libdri should use
libgbmordri-pkgconfig-stubas inputs, respectively
GNU Taler has been updated to version 1.0. This marks a significant milestone as the GNU Taler payment system is now available in Swiss Francs for individuals and businesses in Switzerland. For more details, see the upstream release notes.
OpenSSH has been updated from 9.9p2 to 10.0p2, dropping support for DSA keys and adding a new
ssh-authbinary to handle user authentication in a different address space from unauthenticated sessions. See the full changelog for more details.Emacs has been updated to 30.1. This introduces some backwards‐incompatible changes; see the NEWS for details. NEWS can be viewed from Emacs by typing
C-h n, or by clickingHelp->Emacs Newsfrom the menu bar. It can also be browsed online.The
intelvideo driver for X.org (from the xf86-video-intel package, which was previously removed because it was non-functional) has been fixed and the driver has been re-introduced.The default openexr version has been updated to 3.2.4.
The default PHP version has been updated to 8.4.
The default Erlang OTP version has been updated to 27.
The default Elixir version has been updated to 1.18.
Backward Incompatibilities
apptainerandsingularitydeprecate the workaround of overridingvendorHashand related attributes via<pkg>.override, in favour of the unified overriding of the same group of attributes via<pkg>.overrideAttrs. The compatibility layer will be removed in future releases.squidhas been updated to version 7, this release includes multiple breaking changes, like ESI removal. For more information, check the release notes.postgresqlandlibpqdon’t providepg_configby default anymore. Instead,pg_configis available viapostgresql.pg_configorlibpq.pg_config. This allowed implementing it as a shell script, which can be built for both the build and host systems when cross-compiling. If your build fails to findpg_config, addpostgresql.pg_configorlibpq.pg_configtonativeBuildInputs.postgresql_13has been removed since it reached its end of life.The
no-broken-symlinkshook was added to catch builds containing dangling or reflexive symlinks, as these are indicative of problems with packaging. The hook can be disabled by providingdontCheckForBrokenSymlinks = true;as an argument tomkDerivation. For more information, check the docs or see this PR.gkrakenhas been removed. The recommended alternative iscoolercontrol.opensmtpd-extrashas been deprecated by upstream and is not compatible with OpenSMTPD 7.6.0 or later. The package has been removed in favor of a set of newopensmtpd-table-*packages.postsrsdupgraded to>= 2.0.0, with some different behaviors and configuration settings. Notably, it now defaults to listening on a socket rather than a port. See Migrating from version 1.x and Postfix Setup for details.renovatewas updated to v39. See the upstream release notes for breaking changes. Like upstream’s Docker images, renovate now runs on NodeJS 22.The handwritten
perlPackages.SearchXapianbindings have been dropped in favor of the (mostly compatible)perlPackages.Xapian.varnishwas updated from 7.5.0 to 7.7.0, see Varnish 7.6.0 upgrade guide and Varnish 7.7.0 upgrade guide.The
configtriple foraarch64-darwinhas been changed fromaarch64-apple-darwintoarm64-apple-darwinto match the Apple toolchain and LLVM’s expectations.The
electronpackages will now provide their headers (available viaelectron.headers) in extracted form instead of in a tarball.The udev rules of the
libjaylinkpackage require users to be in thejlinkinstead ofplugdevgroup now, since theplugdevgroup is very uncommon for NixOS. Alternatively, access is granted to seat sessions.The
ephemeralpackage was removed due to upstream archival in early 2022.The
gotenbergpackage has been updated to 8.16.0, which brings breaking changes to the configuration from version 8.13.0. See the upstream release notes for that release to get all the details.zammadhas had its support for MySQL removed, since it was never working correctly and is now deprecated upstream. Check the migration guide for how to convert your database to PostgreSQL.The
vocalpackage was removed due to upstream archival. The upstream developer suggests usinggnome-podcastsorkastsinstead.timescaledbrequires manual upgrade steps. After you run ALTER EXTENSION, you must run this SQL script. For more details, see the following pull requests #6797. PostgreSQL 13 is no longer supported in TimescaleDB v2.16.paperless-ngxhas been updated to minor version 2.15 which switched the web server from Gunicorn to Granian. If you set Gunicorn specific envs (usually contain GUNICORN) they must be updated.testers.shellcheck now warns when
nameis not provided. Thenameargument will become mandatory in a future release.tauon7.9.0+ when launched for the first time, migrates its database to a new schema that is not backwards compatible. Older versions will refuse to start at all with that database afterwards. If you need to still use older tauon versions, make sure to back up~/.local/share/TauonMusicBox.aws-workspaceshas dropped support for PCoiP networking.GIMP 3.0 available as
gimp3.grafana-agentandservices.grafana-agenthave been removed in favor of Grafana Alloy (grafana-alloyandservices.alloy), as they depend on an EOL compiler version and will become EOL during the 25.05 lifecycle. Grafana recommends migrating tografana-alloy(services.alloy). See https://grafana.com/docs/alloy/latest/set-up/migrate/ for details.slskdhas been updated to v0.22.3, which includes breaking changes toscriptintegrations. Please review the changelog and the accompanying pull request.forgejoandforgejo-ltshave been updated to v11. See upstreams release blog post for more information.unifihas been updated to v9.1. This version should be backward compatible with v8.x, however as a result,unifi8package has been removed.xdragonpackage has been renamed todragon-drop.xdragonis an alias todragon-dropand the package still providesbin/xdragon.bin/dragonis no longer supplied.python3Packages.bpycvhas been removed due to being incompatible with Blender 4 and unmaintained.python3Packages.jaeger-clientwas removed because it was deprecated upstream. OpenTelemetry is the recommended replacement.rocmPackages_6has been updated to ROCm 6.3.rocmPackages_5has been removed.rocmPackages.rocm-thunkhas been removed and its functionality has been integrated with the ROCm CLR. UserocmPackages.clrinstead.rocmPackages.clang-oclhas been removed. It was deprecated by AMD in 2023.nodePackages.meshcommanderhas been removed, as the package was deprecated by Intel.The default version of
z3has been updated from 4.8 to 4.13. There are still a few packages that need specific older versions; those will continue to be maintained as long as other packages depend on them but may be removed in the future.The
nixLog*family of functions made available through the standard environment have been rewritten to prefix messages with both the debug level and the function name of the caller. ThenixLogfunction, which logs unconditionally, was also re-introduced and modified to prefix messages with the function name of the caller. For more information, see this PR.postgresql’spythonSupportargument has been changed. It is now enabled by default, but to use PL/Python the extension needs to be added explicitly withpostgresql.withPackages. If you were usingpostgresql.override { pythonSupport = true; }before, change it topostgresql.withPackages (ps: [ ps.plpython3 ]). The same applies toperlSupport/plperlandtclSupport/pltclrespectively.Rust packages will need to regenerate their
cargoHash. Cargo 1.84.0 changed the format ofcargo vendoroutput, which invalidated all existingrustPlatform.fetchCargoTarballhashes. To preserve Nix’s invariants, it has been replaced withrustPlatform.fetchCargoVendor, an independent implementation prioritizing format stability.rustPlatform.buildRustPackagenow usesrustPlatform.fetchCargoVendorby default; a hash mismatch error is expected in third‐party Rust packages when updating to Nixpkgs 25.05. Packages wishing to maintain compatibility with Nixpkgs 24.11 must explicitly setuseFetchCargoVendortotrue.rustPlatform.importCargoLockmay also be appropriate in some circumstances.cassandra_3_0andcassandra_3_11have been removed as they have reached end-of-life. Please update tocassandra_4. See the changelog for more information about the upgrade process.mariadb_105has been removed as it has reached end-of-life in 2025-06. Please update tomariadb_106.NetBox was updated to
>= 4.2.0. Have a look at the breaking changes of the 4.1 release and the 4.2 release, make the required changes to your database, if needed, then upgrade by settingservices.netbox.package = pkgs.netbox_4_2;in your configuration.nodePackages.expo-clihas been removed, as it was deprecated by upstream. The suggested replacement is thenpx expocommand.The
conduwuitmatrix server implementation has officially been discontinued by upstream and the package has thus been marked as vulnerable, as it is a security-sensitive package that has reached EOL.NetBox version 4.0.X available as
netbox_4_0was removed. Please upgrade to4.2.golangci-linthas reachedv2. Please read the changes and view the migration guide here.i3status-rust-package no longer enablesnotmuchby default. It can be enabled viawithNotmuch.ocis-binhas been renamed toocis_5-bin. Future versions will have the major version suffix.All support for 32‐bit Darwin systems has been dropped.
substituteAllandsubstituteAllFileshave been deprecated in favor ofreplaceVarsand will be removed in the next release.Default ICU version updated from 74 to 76
The packages
signald,signaldctlandpurple-signaldhave been dropped as they are unmaintained upstream and have been incompatible with the official Signal servers for a long while.Apache Kafka was updated to
>= 4.0.0. Please note that this is the first release which operates entirely without Apache ZooKeeper support, and all clusters need to be migrated to KRaft mode. See the release announcement for more details.ast-grepremoves thesgcommand to prevent conflict with thesgcommand from shadow-utils. If you need legacy sg command compatibility with old code, you can useast-grep.override { enableLegacySg = true; }rename package
wtftowtfutil.python3Packages.beancountwas updated to 3.1.0. Previous major version remains available aspython3Packages.beancount_2.wastebinhas been updated to 3.0.0. See the Changelog for breaking changes to the configuration.binwalkwas updated to 3.1.0, which has been rewritten in Rust. The Python module is no longer available. See the release notes of 3.1.0 for more information.pkgs.nextcloud28andpkgs.nextcloud29have been removed since they are out of support upstream.centrifugowas updated to v6, which uses a new config format. See upstream documentation for migration.teleporthas been upgraded from major version 16 to major version 17. Refer to upstream upgrade instructions and release notes for v17.Emacs lisp build helpers, such as
emacs.pkgs.melpaBuild, now enables__structuredAttrsby default. Environment variables have to be passed via theenvattribute.buildGoModulenow passes environment variables via theenvattribute.CGO_ENABLEDshould now be specified withenv.CGO_ENABLEDwhen passing to buildGoModule. Direct specification ofCGO_ENABLEDis now redirected by a compatibility layer with a warning, but will become an error in future releases.Go-related environment variables previously shadowed by
buildGoModulenow results in errors when specified directly. Such variables includeGOOSandGOARCH.Third-party projects supporting both stable and unstable channels could detect this change through the absence of the
CGO_ENABLEDfunction argument inbuildGoModule(!((lib.functionArgs buildGoModule) ? CGO_ENABLED)).buildGoPackagehas been removed. UsebuildGoModuleinstead. See the Go section in the nixpkgs manual for details.buildGoModulenow supports agoSumattribute (nullby default) to optionally provide a path togo.sumand correctly enabling rebuilds when the file changes.The newly added aliases
go_latestandbuildGoLatestModuleare now available and can be used to prevent packages likegoplsfrom breaking whenever the default toolchain minor version is lagging behind. It can also be used outside of Nixpkgs to get fast access to new Go minor versions without having to wait for a staging cycle that will update the default builder/toolchain.A policy documenting the details of Go toolchain and builder upgrades in Nixpkgs, as well as rules related to using non-default builders like
buildGo1xxModuleandbuildGoLatestModulehas been added in-tree.top-level
playwrightnow refers to the github Microsoft/playwright package instead of the python tester launcher. You can still refer to the python launcher viapython3Packages.toPythonApplication python3Packages.playwrightThe representation of the flags attributes as shell/environment variables for most Python building setup hooks are now the same as
stdenv.mkDerivationand other build helpers – they are space-separated environment variables when__structuredAttrs = falseand Bash arrays when__structuredAttrs = true, and are concatenated to the command without Bash-evaluation. The following behaviour changes are introduced during the conversion:The following flags are no longer Bash-expanded before concatenated to the command:
disabledTestsanddisabledTestPathsforpytestCheckHook. (disabledTestPathsused to be expanded twice before concatenation.)setupPyBuildFlagsandsetupPyGlobalFlagsforsetuptoolsBuildHook.
pytestFlagsandunittestFlagsreplacepytestFlagsArrayandunittestFlagsArrayand become the new and conforming interface.pytestFlagsArrayandunittestFlagsArrayare kept for compatibility purposes. They continue to be Bash-expanded before concatenated. This compatibility layer will be removed in future releases.
The
hakapackage and module has been removed because the package was broken and unmaintained for 9 years.The
gsignondpackage, plugins and module have been removed because they were unmaintained for 6 years.strawberryhas been updated to 1.2, which drops support for the VLC backend and Qt 5. Thestrawberry-qt5package andwithGstreamer/withVlcoverride options have been removed due to this.nexusmods-apphas been upgraded from version 0.6.3. If you were running a version older than 0.7.0, then before upgrading, you must reset all app state (mods, games, settings, etc). Otherwise, NexusMods.App will crash due to app state files incompatibility.Typically, you can reset to a clean state by running
NexusMods.App uninstall-app. See Nexus Mod’s how to uninstall the app documentation for more detail and alternative methods.This should not be necessary going forward, because loading app state from 0.7.0 or newer is now supported. This is documented in the 0.7.1 changelog.
nezhaand its agentnezha-agenthave been updated to v1, which contains breaking changes. See the official wiki for more details.ps3-disc-dumperwas updated to 4.2.5, which removed the CLI project and now exclusively offers the GUIkmonadis now hardened by default using commonsystemdsettings. If KMonad is used to execute shell commands, hardening may make some of them fail. In that case, you can disable hardening using theservices.kmonad.keyboards.<name>.enableHardeningoption.isdwas updated from 0.2.0 to 0.5.1, the new version may crash with a previously generated config, try moving or deleting~/.config/isd/schema.json.uwsgino longer supports Python 2 plugins.Support for CUDA 10 has been dropped, as announced in the 24.11 release notes.
mepowas updated to version 1.3.3. The manual page was removed, a new JSON API was introduced to replace Mepolang for configuration, and a few default key bindings were changed. See the 1.3.0 changelog for more details.mkBinaryCachenow defaults to usingzstdcompression for the binary caches it creates. The previousxzcompression method can be used by passingcompression = "xz";.nodejs_latestwas updated from 23.x to 24.x.nodejs_23has been removed in favor ofnodejs_24.nodejs_18package was removed due to upstream End-of-Life in April 2025.nodePackages."@commitlint/config-conventional"has been removed, as it is a library, and projects should depend on it instead.zigbee2mqtt is now available in version 2.x as
zigbee2mqtt_2. In NixOS 25.11 we’ll removezigbee2mqtt_1and default tozigbee2mqtt_2. See the breaking changes announcement for 2.0.0.nodePackages.vlshas been deprecated, as the upstream consumer of it, vetur, has been deprecated by upstream. Upstream suggests migrating to Volar for Vue LSP tooling instead.nodePackages.create-react-native-apphas been removed, as it is deprecated. Upstream suggests using a framework for React Native apps instead.nodePackages.insecthas been removed, as it’s deprecated by upstream. The suggested replacement isnumbat.nodePackages.webpack-dev-serverhas been removed, as it should be installed in projects that use it instead.nodePackages.copy-webpack-pluginhas been removed, as it should be installed in projects that use it instead.himalayahas been updated fromv1.0.0-beta.4tov1.1.0, which introduces breaking changes. Check out the release notes for details.linuxPackages.nvidiaPackages.dc_520has been removed since it is marked broken and there are better newer alternatives.pnpmwas updated to version 10. If your project is incompatible, you can install the previous version from the package attributepnpm_9.dwarf-fortress-packagesnow only contains one minor version for each major version since version 0.44. Saves should still be compatible, but you may have to change which minor version you were using if it was one other than the newest.tpm2-pkcs11now is compiled withoutabrmd(Access Broker and Resource Manager Daemon) support by default, preferring the kernel resource manager. Usetpm2-pkcs11.abrmdif you would like a version withabrmdsupport. Note that the NixOS module picks the correct one automatically based onsecurity.tpm2.abrmd.zig_0_9andzig_0_10have been removed, you should upgrade tozig_0_13(also available as justzig),zig_0_12orzig_0_11instead.webpack-cliwas updated to major version 6, which has breaking changes from the previous version 5.1.4. See the upstream release notes for details on these changes.minetesthas been renamed toluantito match the upstream name change but aliases have been added. The new name hasn’t resulted in many changes as of yet but older references to minetest should be sunset. See the new name announcement for more details.poachas been renamed tocabinpkgto match the upstream name change but an alias has been added. See the new name announcement for more details.serious-sanshas been removed because upstream changed its name to Serious Shanns, which is not currently packaged.racket_7_9has been removed, as it is insecure. It is recommended to use Racket 8 instead.rofihas been updated from 1.7.5 to 1.7.6 which introduces some breaking changes to binary plugins, and also contains a lot of new features and bug fixes. This is highlighted because the patch version bump does not indicate the volume of changes by itself. See the upstream release notes for the full list of changes.ente-authnow uses the nameenteauthfor its binary. The previous name wasente_auth.foundationdbwas upgraded to 7.3.fluxushas been removed, as it depends onracket_7_9and had no updates in 9 years.meilisearchhas been upgraded from 1.11.3 to 1.14.0, which requires manually dumping and importing the data. See Meilisearch’s upgrade guide for more information.sm64ex-coophas been removed as it was archived upstream. Consider migrating tosm64coopdx.tldrnow usestldr-python-clientinstead oftldr-c-clientwhich is unmaintained.The behavior of the
networking.nat.externalIPandnetworking.nat.externalIPv6options has been changed.networking.nat.forwardPortsnow only forwards packets destined for the specified IP addresses.python3Packages.bpycvhas been removed due to being incompatible with Blender 4 and unmaintained.python3Packages.jaeger-clientwas removed because it was deprecated upstream. OpenTelemetry is the recommended replacement.nodePackages.meshcommanderhas been removed, as the package was deprecated by Intel.The default version of
z3has been updated from 4.8 to 4.15, and all old versions have been dropped. Note thatfstarstill depends on specific versions, and maintains them as overrides.prometheushas been updated from 2.55.0 to 3.1.0. Read the release blog post and migration guide.kanatawas updated to v1.8.0, which introduces several breaking changes. See the release notes of v1.7.0 and v1.8.0 for more information.autheliaversion 4.39.0 has made changes on the default claims for ID Tokens, to mirror the standard claims from the specification. This change may affect some clients in unexpected ways, so manual intervention may be required. Read the release notes, along with the guide to work around issues that may be encountered.agswas updated to v2, which is just a CLI for Astal now. Components are available as a different package setastal.*. If you want to use v1, it is available asags_1package.See the release notes of v2.0.0 for more information.
nodePackages.expo-clihas been removed, as it was deprecated by upstream. The suggested replacement is thenpx expocommand.open-policy-agenthas been updated to 1.0.0+. This major release makes therego.v1syntax the default. This is a breaking change for those using v0 Rego. See the upgrade documentation for more details. For those unable to upgrade yet, there is a v0 compatibility mode available too.helmfilewas updated to v1.0.0, which introduces several breaking changes. See the release notes of v1.0.0 for more information.vscode-utils.buildVscodeExtensionnow requires pname as an argumentnerdfontshas been separated into individual font packages under the namespacenerd-fonts. The directories for font files have changed from$out/share/fonts/{opentype,truetype}/NerdFontsto$out/share/fonts/{opentype,truetype}/NerdFonts/<fontDirName>, where<fontDirName>can be found in the official website as the titles in preview images, with the “Nerd Font” suffix and any whitespaces trimmed. Configuration changes are required, see build output.retroarchhas been refactored and the olderretroarch.override { cores = [ ... ]; }to create a RetroArch derivation with custom cores doesn’t work anymore, useretroarch.withCores (cores: [ ... ])instead. If you need more customization (e.g.: custom settings), usewrapRetroArchinstead.borgmatichas been updated from 1.8.14 to 1.9.5, please check the upstream changelog for more details, especially for a few possibly breaking changes noted in the 1.9.0 changelog.nodePackages.ganachehas been removed, as the package has been deprecated by upstream.matomonow defaults to version 5 (previously available asmatomo_5). Version 4 has been removed as it reached EOL on December 19, 2024.matomo-betahas been removed as the version of thematomopackage can now be easily overridden throughoverrideAttrs(see PR #374022)docker_24has been removed, as it was EOL with vulnerabilities since June 08, 2024.Emacs 28 and 29 have been removed.
Emacs 28 Macport has been removed, while CVEs of Emacs 29 Macport are patched.
containerdhas been updated to v2, which contains breaking changes. See the containerd 2.0 documentation for more details.The
tinyccpackage now has thedev,docandliboutputs, thus,tinycc.outmay now only provide the tcc and cross compilers binaries.The
testTargetargument ofhaskellPackages.mkDerivationhas been deprecated in favour oftestTargets.testTargettook a space separated string of targets, whereas the newtestTargetsargument takes a list of targets. For instance,testTarget = "foo bar baz"should becometestTargets = [ "foo" "bar" "baz" ].rustPlatform.buildRustPackagestops handling the deprecated argumentcargoSha256. Out-of-tree packages that haven’t migrated fromcargoSha256tocargoHashnow receive errors.nodePackages.stackdriver-statsd-backendhas been removed, as the StackDriver service has been discontinued by Google, and therefore the package no longer works.python3Packages.opentracinghas been removed due to being unmaintained upstream. OpenTelemetry is the recommended replacement.the notmuch vim plugin now lives in a separate output of the
notmuchpackage. Installingnotmuchwill not bring the notmuch vim package anymore, addvimPlugins.notmuch-vimto your (Neo)vim configuration if you want the vim plugin.The fileSystems (e.g.,
fileSystems."/") are now set by NixOS-implemented modules usinglib.mkDefault, allowing wholesale overrides, but this means that overriding individual attributes (likefsTypeoroptions) without explicitly specifyingdevicemay result in missing required fields and errors such asNo device specified for mount point '/'(https://github.com/NixOS/nixpkgs/pull/377406).prismaandprisma-engineshave been updated to version 6.7.0, which introduces several breaking changes. See the Prisma ORM upgrade guide for more information.dependency-trackno longer bundles the UI inside the jar. This bundling functionality is deprecated by upstream and causes UI assets not being served after weeks of runtime.nqwas updated to 1.0, which renames thefqandtqutilities tonqtailandnqtermrespectively.zfwas updated to 0.10.2, which includes breaking changes from the 0.10.0 release.zfno longer does Unicode normalization of the input and no longer supports terminal escape sequences in theZF_PROMPTenvironment variable.confluent-cliwas updated from 3.60.0 to 4.16.0, which includes several breaking changes as detailed in Confluent’s release notes.siduck76-sthas been renamed tost-snazzy, like the project’s flake. An alias for the old name has been added.python3Packages.jaxnow directly depends onpython3Packages.jaxlib. As a result, packages that depend on jax no longer need to include jaxlib to their dependencies. There is also a breaking change in the handling of CUDA. Instead of using a CUDA-compatible jaxlib as before, you can use plugins likepython3Packages.jax-cuda12-plugin.Added
allowVariantsto gate availability of package sets likepkgsLLVM,pkgsMusl,pkgsZig, etc. This was done in an effort to decrease evaluation times by limiting the number of instances of nixpkgs to evaluate. The option will be removed in the future as a new mechanism is in the works for handling cross compilation.
Other Notable Changes
i18nmodule improvements:i18n.extraLocalesshould now be the preferred way to install additional locales.i18n.supportedLocalesis now considered an implementation detail and will be hidden from the documentation. But the option will still continue to work.i18n.supportedLocaleswill now trigger a warning when it omits any locale set ini18n.defaultLocale,i18n.extraLocalesori18n.extraLocaleSettings.The options
i18n.defaultCharset&i18n.localeCharsetswere added, and they complementi18n.defaultLocale&i18n.extraLocaleSettingsrespectively - allowing to control the character set used per locale setting.
Plasma 5 and Qt 5 based versions of associated software are deprecated in NixOS 25.05, and will be removed in NixOS 25.11. Users are encouraged to upgrade to Plasma 6.
titaniumenv,titanium, andtitanium-alloyhave been removed due to lack of maintenance in Nixpkgs .Cursor — a vscode-based editor that uses AI to help you write code faster — has been packaged as
cursor.octave(andoctaveFull) was updated to version10.x. The update broke a fewoctavePackages, andlibrsb. See the PR’s commits for more details.androidenv has been improved:
All versions specified in composeAndroidPackages now track the latest. Android packages are automatically updated on unstable, and run the androidenv test suite on every update.
Many androidenv packages are now searchable on search.nixos.org.
We now use the latest Google repositories, which should improve aarch64-darwin compatibility. The SDK now additionally evaluates on aarch64-linux, though not all packages are functional.
dwarf-fortressaudio now works again. Additionally, thedfhackanddwarf-fortress-fullpackages are now exposed at toplevel, making it easier to install and play Dwarf Fortress. Note thatdwarf-fortress-fullis the Nixpkgs equivalent of the Dwarf Fortress Lazy Pack.gerberanow has wavpack support.buildPythonPackage,buildPythonApplicationand the Python building setup hooks now support both__structuredAttrs = trueand__structuredAttrs = false.buildGoModulenow supports a self-referencingfinalAttrs:parameter containing the final arguments including overrides. This allows packaging configuration to be overridden in a consistent manner by providing an alternative torec {}syntax.Caddy can now be built with plugins by using
caddy.withPlugins, apassthrufunction that accepts an attribute set as a parameter. Thepluginsargument represents a list of Caddy plugins, with each Caddy plugin being a versioned module. Thehashargument represents thevendorHashof the resulting Caddy source code with the plugins added.Example:
let pkgs = import <nixpkgs> { }; in pkgs.caddy.withPlugins { plugins = [ # tagged upstream "github.com/caddy-dns/powerdns@v1.0.1" # pseudo-version number generated by Go "github.com/caddy-dns/cloudflare@v0.0.0-20240703190432-89f16b99c18e" "github.com/mholt/caddy-webdav@v0.0.0-20241008162340-42168ba04c9d" ]; hash = "sha256-wqXSd1Ep9TVpQi570TTb96LwzNYvWL5EBJXMJfYWCAk="; }To get the necessary hash of the vendored dependencies, omit
hash. The build will fail and tell you the correct value.Note that all provided plugins must have versions/tags (string after
@), even if upstream repo does not tag each release. For untagged plugins, you can either create an empty Go project and rungo get <plugin>and see changes ingo.modto get the pseudo-version number, or provide a commit hash in place of version/tag for the first run, and update the plugin string based on the error output.The
godot-export-templatespackage now has its content atshare/godot/export_templates/$versioninstead of the output root. This makes it more convenient for symlinking into~/.local, but scripts expecting the old layout will need to be changed.GOverlay has been updated to 1.2, please check the upstream changelog for more details.
tpm2-pkcs11now has the varianttpm2-pkcs11-fapi, which has been patched to default to the Feature API backend. It has also been split intotpm2-pkcs11-esapi, which only supports the older Enhanced System API backend. Note the differences, and thattpm2-pkcs11itself still needsTPM2_PKCS11_BACKEND=fapiexported in order to use the Feature API, whereastpm2-pkcs11-fapidoes not, andtpm2-pkcs11-esapijust does not support fapi entirely.For matrix homeserver Synapse we are now following the upstream recommendation to enable jemalloc as the memory allocator by default.
Mattermost, a self-hosted chat collaboration platform supporting calls, playbooks, and boards, has been updated. It now has multiple versions, disabled telemetry, and a native frontend build in nixpkgs, removing all upstream prebuilt blobs.
A new
pkgs.mattermost.buildPluginfunction has been added, which allows plugins to be built from source, including webapp frontends with a supported package-lock.json. See the Mattermost NixOS test and manual for an example.The Mattermost frontend is now built from source and can be overridden. Note that the Mattermost derivation containing both the webapp and server is now wrapped to allow them to be built independently, so overrides to both webapp and server look like
mattermost.overrideAttrs (prev: { webapp = prev.webapp.override { ... }; server = prev.server.override { ... }; })now.pkgs.mattermosthas been updated from 9.11 to 10.5 to track the latest extended support release, since 9.11 will become end-of-life during the lifetime of NixOS 25.05.pkgs.mattermostLatestis now an option to track the latest (non-prerelease) Mattermost release. We test upgrade migrations from ESR releases (pkgs.mattermost) topkgs.mattermostLatest.
A new hardening flag,
nostrictaliasingwas made available, corresponding to the gcc/clang option-fno-strict-aliasing.The
stackclashprotectionhardening flag has been enabled by default on compilers that support it.In
dovecotpackage, the hardcoded path to the module directory has been removed.autheliaversion 4.39.0 has made some changes which deprecate older configurations. They are still expected to be working until future version 5.0.0, but will generate warnings in logs. Read the release notes for human readable summaries of the changes.hddfancontrolhas been updated to major release 2. See the migration guide, as there are breaking changes.nextcloud-news-updateris unmaintained and was removed from Nixpkgs.KDE Partition Manager
partitionmanager’s support for ReiserFS is removed. ReiserFS has not been actively maintained for many years. It has been marked as obsolete since Linux 6.6, and is removed in Linux 6.13.gerberanow has wavpack support.signal-desktophas been migrated to a from source build. No state migration is necessary. In case there’s no working source build available (like on Darwin), the binary build is still available atsignal-desktop-bin.ddclientwas updated from 3.11.2 to 4.0.0 Release notes
Nixpkgs Library
Breaking changes
Structure of the
functorof some types has changed.functoris an implementation detail and should not be relied upon. If you did rely on it let us know in this PR.lib.types.enum: Previously thefunctor.payloadwas the list of enum values directly. Now it is an attribute set containing the values in thevaluesattribute.lib.types.separatedString: Previously thefunctor.payloadwas the separator directly. Now it is an attribute set containing the separator in thesepattribute.
lib.packagesFromDirectoryRecursivenow rejects unknown arguments.
Deprecations
functoris an implementation detail and should not be relied upon, but since its status wasn’t clear and it has had some use cases without alternatives, changes are being handled as gracefully as possible. Deprecations within functor:functor.wrappedis now deprecated for some types and using it will give a warning with migration instructions. It is deprecated for these types:lib.types.attrsWithlib.types.listOflib.types.uniqueandlib.types.uniqlib.types.nullOrlib.types.functionTolib.types.coercedTolib.types.either
Additions and Improvements
lib.packagesFromDirectoryRecursivecan now construct nested scopes matching the directory tree passed as input.
Release 24.11 (“Vicuña”, 2024.11/28)
Highlights
Nix was updated to 2.24, which brings a lot of improvements and fixes. See the release notes for 2.19, 2.20, 2.21, 2.22, 2.23, 2.24. Notable changes include improvements to Git fetching, documentation comment support in
nix-repl> :doc, as well as many quality of life additions.There have been significant changes to macOS support.
The build environment has been redesigned to be closer to a native Xcode toolchain, enabling us to provide all SDKs from macOS Sierra 10.12 to macOS Sequoia 15, simplify build definitions, and build more software without hacks or patching. Although compatibility shims for the old SDK scheme are provided, some builds may break, and the old mechanisms will be removed by 25.11 at the latest. See the Darwin section of the Nixpkgs manual for details of the new scheme and how to use it, and the announcement on Discourse for more information on the changes and benefits.
This will be the last release of Nixpkgs to support macOS Sierra 10.12 to macOS Catalina 10.15. Starting with release 25.05, the minimum supported version will be macOS Big Sur 11, and we cannot guarantee that packages will continue to work on older versions of macOS. Users on old macOS versions should consider upgrading to a supported version (potentially using OpenCore Legacy Patcher for old hardware) or installing NixOS. If neither of those options are viable and you require new versions of software, MacPorts supports versions back to Mac OS X Snow Leopard 10.6.
This will be the last release of Nixpkgs to support versions of CUDA prior to CUDA 12.0. These versions only work with old compiler versions that will be unsupported by the time of the Nixpkgs 25.05 release. In the future, users should expect CUDA versions to be dropped as the compiler versions they require leave upstream support windows.
Convenience options for
amdgpu, the open source driver for Radeon cards, are now available underhardware.amdgpu.AMDVLK, AMD’s open source Vulkan driver, is now available to be configured under the
hardware.amdgpu.amdvlkoption. This also allows configuring runtime settings for AMDVLK, including enabling experimental features.The
moonlight-qtpackage (for Moonlight game streaming) now has HDR support on Linux systems.Sched-ext, a Linux kernel feature to run schedulers in userspace, is now available
services.scx. Requires Linux kernel version 6.12 or later.PostgreSQL now defaults to major version 16.
GNOME has been updated to version 47. Refer to the release notes for more details.
autheliahas been upgraded to version 4.38. This version brings several features and improvements which are detailed in the release blog post. This release also deprecates some configuration keys which are likely to be removed in version 5.0.0.netbirdhas been updated to 0.31.1. This adds a built-in relay server which is not yet supported by the NixOS module, as well as a metrics endpoint for both the management and signal services. The default metrics port for thesignalservice has been changed from9090to9091to prevent a port conflict with the management server. This can be changed with their respectivemetricsPortas needed. Refer to the release notes and this pull request for more information.compressDrvcan compress selected files in a derivation.compressDrvWebcompresses files for common web server usage (.gzwithzopfli,.brwithbrotli).hardware.displayis a new module implementing workarounds for misbehaving monitors by setting up custom EDID files and forcing kernel/framebuffer modes.services.displayManager.lyis a new module for configuring the display manager ly, a TUI-based replacement for SDDM and LightDM meant for window manager users.srcOnlywas rewritten to be more readable, have additional warnings in the event that something is probably wrong, use thestdenvprovided by the derivation, and Noogle-compatible documentation was added.The default sound server for most graphical sessions has been switched from PulseAudio to PipeWire. Users that want to keep using PulseAudio will want to set
services.pipewire.enable = false;andhardware.pulseaudio.enable = true;. There is currently no plan to fully deprecate and remove PulseAudio, however, PipeWire should generally be preferred for new installs.The Rust rewrite of the
switch-to-configurationprogram is now used for system activation by default. If you experience any issues, please report them. The original Perl script is deprecated and is planned for removal in the 25.05 release. It will remain accessible until then by settingsystem.switch.enableNgtofalse.Support for mounting filesystems from block devices protected with dm-verity was added through the
boot.initrd.systemd.dmVerityoption.The Xen Project Hypervisor is once again available as a virtualisation option under
virtualisation.xen.This release includes Xen 4.19.0 and support for booting the hypervisor on EFI systems.
Warning
Booting into the Xen Project Hypervisor through a legacy BIOS bootloader or with the legacy script-based Stage 1 initrd have been deprecated. Only EFI booting and the new systemd-based Stage 1 initrd are supported.
The
qemu-xen-traditionalcomponent has been deprecated by the upstream Xen Project, and is no longer included in the Xen build.The OCaml-based Xen Store can now be configured using
virtualisation.xen.store.settings.The
virtualisation.xen.bridgeoptions have been deprecated in this release cycle. Users who need network bridges are encouraged to set up their own networking configurations.
A new option
systemd.enableStrictShellCheckshas been added. When enabled, all systemd scripts generated by NixOS will be checked with shellcheck and any errors or warnings will cause the build to fail. This affects all scripts that have been created through thescript,reload,preStart,postStart,preStopandpostStopoptions for systemd services. This does not affect commandlines passed directly toExecStart,ExecReload,ExecStartPre,ExecStartPost,ExecStoporExecStopPost. It therefore also does not affect systemd units that are coming from packages and that are not defined through the NixOS config. This option is disabled by default, and although some services have already been fixed, it is still likely that you will encounter build failures when enabling this. We encourage people to enable this option when they are willing and able to submit fixes for potential build failures to nixpkgs. The option can also be enabled or disabled for individual services using theenableStrictShellChecksoption on the service itself, which will take precedence over the global setting.
New Modules
hardware.block allows configuration of I/O schedulers for block devices.
KMonad, an advanced keyboard remapping utility. Available as services.kmonad.
Coral, hardware support for Coral.ai Edge TPU devices. Available as hardware.coral.usb.enable and hardware.coral.pcie.enable.
Cyrus IMAP, an email, contacts and calendar server. Available as services.cyrus-imap service.
TaskChampion Sync-Server, a Taskwarrior 3 sync server. Available as services.taskchampion-sync-server.
FlareSolverr, a proxy server to bypass Cloudflare protection. Available as services.flaresolverr.
Whisparr, an adult movie collection manager for Usenet and BitTorrent users. Available as services.whisparr.
Gancio, a shared agenda for local communities. Available as services.gancio.
Goatcounter, an easy web analytics platform with no tracking of personal data. Available as services.goatcounter.
Privatebin, a minimalist, open source online pastebin where the server has zero knowledge of pasted data. Available as services.privatebin.
UWSM, a wayland session manager to wrap Wayland compositors into useful systemd units such as
graphical-session.target. Available as programs.uwsm.Open-WebUI, a user-friendly WebUI for LLMs. Available as services.open-webui.
Quickwit, a sub-second search & analytics engine on cloud storage. Available as services.quickwit.
Userborn, a service for declarative user management. This can be used instead of the
update-users-groups.plPerl script and/or systemd-sysusers. This is now recommended over systemd-sysusers to achieve a system without Perl, as it can create normal users and change passwords. Available as services.userborn.g810-led, a LED controller for Logitech G keyboards. Available as services.g810-led.
Hatsu, a self-hosted bridge that interacts with Fediverse on behalf of your static site. Available as services.hatsu.
Soteria, a polkit authentication agent to handle elevated prompts for any desktop environment. Normally this should only be used on DEs or WMs that do not provide a graphical polkit frontend on their own. Available as
security.soteria.Flood, a beautiful WebUI for various torrent clients. Available as services.flood.
Niri, a scrollable-tiling Wayland compositor. Available as programs.niri.
Firefly-iii Data Importer, a data importer for Firefly-III. Available as services.firefly-iii-data-importer.
Dashy, an open source, highly customizable, easy to use, privacy-respecting dashboard app. Available as services.dashy.
[QGroundControl], a ground station support and configuration manager for the PX4 and APM Flight Stacks. Available as programs.qgroundcontrol.
Eintopf, a community event and calendar web application. Available as
services.eintopf.pay-respects, a terminal command correction program, alternative tothefuck, written in Rust. Available as programs.pay-respects.Radicle, an open source, peer-to-peer code collaboration stack built on Git. Available as services.radicle.
Ordinal, A library for ordinal numbers in the Coq proof assistant.
ddns-updater, a service with a WebUI to update DNS records periodically for many providers. Available as services.ddns-updater.
Immersed, a closed-source coworking platform. Available as programs.immersed.
HomeBox, an inventory and organization system built for the home user. Available as services.homebox.
evremap, a keyboard input remapper for Linux/Wayland systems. Available as services.evremap.
matrix-hookshot, a Matrix bot for connecting to external services. Available as services.matrix-hookshot.
Renovate, a dependency updating tool for various Git forges and language ecosystems. Available as services.renovate.
Music Assistant, a music library manager for your offline and online music sources that can stream to a wide range of supported players. Available as services.music-assistant.
zeronsd, a DNS server for ZeroTier users. Available with services.zeronsd.servedNetworks.
Collabora Online, a collaborative online office suite based on LibreOffice technology. Available as services.collabora-online.
wg-access-server, an all-in-one WireGuard VPN solution with a WebUI for connecting devices. Available as services.wg-access-server.
Pingvin Share, a self-hosted file sharing platform and an alternative for WeTransfer. Available as
services.pingvin-share.Envision, a UI for building, configuring and running Monado, the open source OpenXR runtime. Available as programs.envision.
Localsend, an open source cross-platform alternative to AirDrop. Available as programs.localsend.
Gatus, an automated developer-oriented status page. Available as services.gatus.
cryptpad, a privacy-oriented collaborative office suite, has been added back. Available as services.cryptpad.
realm, a simple, high performance relay server written in Rust. Available as services.realm.
Gotenberg, an API server for converting files to PDFs that can be used alongside Paperless-ngx. Available as services.gotenberg.
Suricata, a free and open source, mature, fast and robust network threat detection engine. Available as services.suricata.
Playerctld, a daemon to track media player activity. Available as services.playerctld.
Glance, a self-hosted dashboard that puts all your feeds in one place. Available as services.glance.
Apache Tika, a toolkit that detects and extracts metadata and text from over a thousand different file types. Available as services.tika.
Misskey, an interplanetary microblogging platform. Available as services.misskey.
Improved File Manager (IFM), a single-file web-based file manager. Available as services.ifm.
OpenGFW, an implementation of the Great Firewall on Linux. Available as
services.opengfw.Rathole, a lightweight and high-performance reverse proxy for NAT traversal. Available as services.rathole.
Proton Mail bridge, a desktop application that runs in the background, encrypting and decrypting messages as they enter and leave your computer. Available as services.protonmail-bridge.
chromadb, an open-source AI application database with batteries included. Available as services.chromadb.
bitmagnet, a self-hosted BitTorrent indexer, DHT crawler, content classifier and torrent search engine with WebUI, GraphQL API and Servarr stack integration. Available as services.bitmagnet.
Wakapi, a time tracking software for programmers. Available as services.wakapi.
foot, a fast, lightweight and minimalistic Wayland terminal emulator. Available as programs.foot.
ToDesk, a remote desktop application. Available as services.todesk.
Dependency Track, an intelligent Component Analysis platform that allows organizations to identify and reduce risk in the software supply chain. Available as services.dependency-track.
Immich, a self-hosted photo and video backup solution. Available as services.immich.
saunafs, a distributed POSIX file system. Available as services.saunafs.
obs-studio, a free and open source software for video recording and live streaming. Available as programs.obs-studio.
Veilid, a privacy-focused, headless server for data sharing and messaging on a peer-to-peer network. Available as services.veilid.
Fedimint, a module based system for building federated applications (Federated E-Cash Mint). Available as services.fedimintd.
tiny-dfr, a dynamic function row daemon for the Touch Bar found on some Apple laptops. Available as hardware.apple.touchBar.enable.
Swapspace, a dynamic swap space manager that turns your unused free space into swap automatically. Available as services.swapspace.
Zapret, a DPI bypass tool. Available as services.zapret.
Glances, an open-source system cross-platform monitoring tool. Available as services.glances.
Backward Incompatibilities
Nixpkgs now requires Nix 2.3.17 or newer to allow for zstd compressed binary artifacts.
The
soundoptions have been removed or renamed, as they had a lot of unintended side effects. See below for details.The NVIDIA driver no longer defaults to the proprietary kernel module with versions >= 560. You will need to manually set
hardware.nvidia.opento select the proprietary or open modules.The
inteldriver for the X server (services.xserver.videoDrives = [ "intel" ]) is no longer functional due to incompatibilities with the latest Mesa version. All users are strongly encouraged to switch to the genericmodesettingdriver (the default one) whenever possible, for more information see the manual chapter on Intel Graphics and issue #342763.The
intel-compute-runtimepackage dropped support for older GPUs, and only supports 12th Gen and newer from now on. Intel GPUs from Gen 8,9 and 11 need to use theintel-compute-runtime-legacy1package inhardware.graphics.extraPackages.The
(buildPythonPackage { ... }).overrideand(buildPythonPackage { ... }).overrideDerivationattributes is now deprecated and removed in favour ofoverridePythonAttrsandlib.overrideDerivation. This change does not affect the override interface of most Python packages, as<pkg>.overrideprovided bycallPackageshadows such a locally-definedoverrideattribute. The<pkg>.overrideDerivationattribute of Python packages called withcallPackagewill also remain available after this change.All Cinnamon and XApp packages have been moved to top-level (i.e.,
cinnamon.nemois nownemo).All GNOME packages have been moved to top-level (i.e.,
gnome.nautilusis nownautilus).transmissionhas been aliased with atracewarning totransmission_3, since Transmission 4 has been released last year and Transmission 3 will eventually go away – this is meant to make people aware of the new version.services.transmission.packagenow also defaults totransmission_3, as the upgrade can cause data loss in some cases (examples: #5153, #6796). Please make sure to back up to your data directory if you may be affected:transmission-gtk:~/.config/transmissiontransmission-daemonusing NixOS module:${config.services.transmission.home}/.config/transmission-daemon(defaults to/var/lib/transmission/.config/transmission-daemon)
The default
mongodbversion has been updated from 5.0 to 7.0. For more information, see the compatibility changes for MongoDB 6.0 and 7.0.unifihas been updated to UniFi 8.unifi7was removed as it is vulnerable to CVE-2024-42025 and required a version of MongoDB that has reached end of life.androidenv.androidPkgs_9_0has been removed. It is replaced withandroidenv.androidPkgsfor a more complete Android SDK, including support for Android 9 and later.The VirtualBox demo installer appliance has been removed. Please use the standard installer ISOs instead.
grafanahas been updated to version 11.3. This version doesn’t support settinghttp_addrto a hostname anymore, an IP address is expected.denohas been updated to Deno 2, which has breaking changes. See the migration guide for details.gogshas been removed. Upstream development has stalled and it has several critical vulnerabilities that weren’t addressed within a year. Consider migrating toforgejoorgitea.knot-dnshas been updated to version 3.4.x. Check the migration guide for breaking changes.mutmuthas been updated to version 3.0.5.services.kubernetes.kubelet.clusterDnsnow accepts a list of DNS resolvers rather than a single string, bringing the module more in line with the upstream Kubelet configuration schema.bluemaphas changed the format used to store map tiles, and the database layout has been heavily modified. Upstream recommends a clean reinstallation: https://github.com/BlueMap-Minecraft/BlueMap/releases/tag/v5.2. Unless you are using an SQL storage backend, this should only entail deleting the contents ofconfig.services.bluemap.coreSettings.data(defaults to/var/lib/bluemap) andconfig.services.bluemap.webRoot(defaults to/var/lib/bluemap/web).wstunnelhas had a major version upgrade that entailed rewriting the program in Rust. The module was updated to accommodate for breaking changes and breaking changes to the module options were minimised as much as possible. Nonetheless, some were inevitable due to changes in the upstream CLI. Certain options were moved from separate CLI arguments into the forward specifications, and those options were also removed from the module’s options. Please consult the wstunnel man page for more details. Also be aware that if you have set additional options inservices.wstunnel.{clients,servers}.<name>.extraArgs, they may have been modified or removed upstream.gnatandgnatPackagesnow use GNAT 13 instead of GNAT 12. This matches the defaultgccversion.percona-server_8_4andmysql84now have password authentication via the deprecatedmysql_native_passworddisabled by default. This authentication plugin can be enabled via a CLI argument again, for detailed instructions and alternative authentication methods see upstream documentation. The config file directivedefault_authentication_pluginhas been removed.Percona has decided not to follow the LTS/ Innovation release scheme of upstream MySQL and thus will only create releases for MySQL LTS versions. Hence, the package names
percona-server_lts,percona-server_innovation,percona-xtrabackup_ltsandpercona-xtrabackup_innovationare deprecated.percona-serverandpercona-server_ltsnow point towards the new LTS releasepercona-server_8_4. The previous LTS continues to be supported and is available aspercona-server_8_0. The same is true for the supportingpercona-xtrabackuptooling.
clang-tools_<version>packages have been moved intollvmPackages_<version>(i.e.clang-tools_18is nowllvmPackages_18.clang-tools).For convenience, the top-level
clang-toolsattribute remains and is now bound tollvmPackages.clang-tools.Top-level
clang_tools_<version>attributes are now aliases; these will be removed in a future release.
buildbotwas updated to 4.0 and the AngularJS frontend replaced by a React frontend. See the upstream release notes.headscalehas been updated to version 0.23.0 which reworked large parts of the configuration, including DNS, Magic DNS prefixes and ACL policy files. See the upstream changelog for details.nginxpackage no longer includes thegdandgeoipdependencies. To re-enable them, overridenginxwith the optionswithImageFilter = true;andwithGeoIP = true;.systemd.enableUnifiedCgroupHierarchyhas been removed. In systemd 256, support for cgroup v1 (‘legacy’ and ‘hybrid’ hierarchies) is now considered obsolete and systemd will refuse to boot under it by default. To forcibly re-enable cgroup v1 support, you can setboot.kernelParams = [ "systemd.unified_cgroup_hierarchy=0" "SYSTEMD_CGROUP_ENABLE_LEGACY_FORCE=1" ]. This is not an officially supported configuration and might cause your system to become unbootable in future versions. You are on your own.nrfutil– which previously pointed to the now-deprecatedpc-nrfutilPython package – has been repackaged under the same name with the new nrfutil tool.opensshandopenssh_hpnare now compiled without Kerberos 5 / GSSAPI support in an effort to reduce the attack surface of the components. Users needing this support can use the newopensshWithKerberosandopenssh_hpnWithKerberospackage flavors (e.g.programs.ssh.package = pkgs.openssh_gssapi).security.ipa.ipaHostnamenow defaults to the value ofnetworking.fqdnif it is set, instead of the previous hardcoded default of${networking.hostName}.${security.ipa.domain}.The
MSMTP_QUEUEandMSMTP_LOGenvironment variables accepted bymsmtpqhave been renamed toMSMTPQ_QandMSMTPQ_LOGrespectively.The logrotate service has been hardened and now requires enabling
allowNetworkingif network access is required.mautrix-whatsapphas been updated to version 0.11.0, which is a major rewrite of the bridge. Config file changes are required.qBittorrent has been updated to major version 5, which drops support for Qt 5. The
qbittorrent-qt5package has been removed.The fcgiwrap module now allows multiple instances running as distinct users. The option
services.fgciwrapnow takes an attribute set of the configuration of each individual instance. This requires migrating any previous configuration keys fromservices.fcgiwrap.*toservices.fcgiwrap.instances.some-instance.*. The ownership and mode of the UNIX sockets created by this service are now configurable and private by default. Processes also now run as a dynamically allocated user by default instead of root.The
mautrix-signalmodule was adapted to incorporate the configuration changes that resulted from the update to the mautrix bridgev2 architecture. Pre-0.7.0 configurations should continue to work. In case you want to update your configuration, make sure to check the NixOS manual.cargo-taurihas been updated to major version 2. Please review the migration guide. v1 ofcargo-tauriis still available ascargo-tauri_1, but will be removed in future releases.The nvidia driver no longer defaults to the proprietary driver starting with version 560. You will need to manually set
hardware.nvidia.opento select the proprietary or open driver.postgresql_12has been removed since it reached its end of life.postgresqlno longer accepts theenableSystemdoverride. UsesystemdSupportinstead.postgresqlwas split into default and -dev outputs. To make this work without circular dependencies, the output of thepg_configsystem view has been removed. Thepg_configbinary is provided in the -dev output and still works as expected.The arguments from
services.postgresql.initdbArgsnow get shell-escaped.postgresqlis now hardened by default using the commonsystemdsettings for that.The dhcpcd service (
networking.useDHCP) has been hardened and now runs exclusively as the “dhcpcd” user. Users that were relying on the root privileges innetworking.dhcpcd.runHookwill have to write specific sudo or polkit rules to allow dhcpcd to perform privileged actions.As part of these changes, the DHCP lease files directory has also been moved from
/var/db/dhcpcdto/var/lib/dhcpcd. This migration is performed automatically, but users may have to update their backup configuration.singularity-toolshave thestoreDirargument removed from its override interface and usebuiltins.storeDirinstead.The
mkLayerandshellScriptbuild helpers insingularity-toolsare deprecated, as they are no longer involved in image-building. Maintainers will remove them in future releases.The
rust.toTargetArch,rust.toTargetOs,rust.toTargetFamily,rust.toTargetVendor,rust.toRustTarget,rust.toRustTargetSpec,rust.toRustTargetSpecShort, andrust.IsNoStdTargetfunctions are deprecated in favour of therust.platform.arch,rust.platform.os,rust.platform.target-family,rust.platform.vendor,rust.rustcTarget,rust.rustcTargetSpec,rust.cargoShortTarget,rust.cargoEnvVarTarget, andrust.isNoStdTargetplatform attributes respectively.All Budgie and
budgiePluginspackages have been moved to top-level (i.e.,budgie.budgie-desktopis nowbudgie-desktopandbudgiePlugins.budgie-media-player-appletis nowbudgie-media-player-applet).The method of safely handling secrets in the
networking.wirelessmodule has been changed to benefit from a new feature ofwpa_supplicant. The syntax to refer to secrets has changed slightly and the optionnetworking.wireless.environmentFilehas been replaced bynetworking.wireless.secretsFile; see the description of the latter for how to upgrade.NetBox was updated to
>= 4.1.0. Have a look at the breaking changes of the 4.0 release and the 4.1 release, make the required changes to your database, if needed, then upgrade by settingservices.netbox.package = pkgs.netbox_4_1;in your configuration.services.cgitnow runs as the cgit user by default instead of root. This change requires granting access to the repositories to this user or setting the appropriate one throughservices.cgit.some-instance.user.All Oracle JDKs and JREs (
oraclejdk,oraclejdk8,oraclejre,oraclejre8,jrePlugin,jre8Plugin,jdkdistro,oraclejdk8distro, andoraclejdk11) were dropped due to being unmaintained and heavily insecure. OpenJDK provides compatible replacements for JDKs and JREs.gradle_6was removed due to being unsupported upstream as of 10 Feb 2023. Additionally, it had numerous security vulnerabilities that were only patched in later versions, such as CVE-2021-29429, CVE-2021-29427, CVE-2021-29428, and CVE-2021-32751.nvimpagerwas updated to version 0.13.0, which changes the order of user and nvimpager settings: user commands in-cand--cmdnow override the respective default settings because they are executed later.javacard-devkitwas dropped due to having a dependency on the Oracle JDK, as well as being several years out-of-date.Kubernetes
featureGateshave changed from alistOf strtoattrsOf bool. This refactor makes it possible to also disable feature gates, without having to useextraOptsflags.A previous configuration may have looked like this:
{ featureGates = [ "EphemeralContainers" ]; extraOpts = pkgs.lib.concatStringsSep " " ([ ''--feature-gates="CSIMigration=false"'' ]); }Using an attribute set instead, the new configuration would be:
{ featureGates = { EphemeralContainers = true; CSIMigration = false; }; }pkgs.nextcloud27has been removed as it has reached EOL.The
environment.noXlibsoption has been removed. It was a common source of unexpected rebuilds and breakage that was often hard to diagnose. If you need to disable certain libraries, you’re encouraged to add your own overlay to your configuration that targets the packages you care about.frigatewas updated past 0.14.0. This release includes various breaking changes, so please review the release notes. Most prominently, access to the web interface and API are now protected by authentication. Retrieve the auto-created admin account from thefrigate.servicejournal after upgrading.nodePackages.coc-pythonwas dropped, as its upstream is unmaintained. The associatedvimPlugins.coc-pythonwas also dropped. The upstream project recommends usingcoc-pyrightorcoc-jedias replacements.forgejohas been upgraded from version 7.0 to version 9.0, see the release notes for 8.0 and 9.0.services.forgejo.mailerPasswordFilehas been deprecated by the drop-in replacementservices.forgejo.secrets.mailer.PASSWD, which is part of the new free-formservices.forgejo.secretsoption.services.forgejo.secretsis a small wrapper over systemd’sLoadCredential=. It has the same structure (sections/keys) asservices.forgejo.settingsbut takes file paths that will be read before service startup instead of some plaintext value.services.forgejo.packagenow defaults toforgejo-lts, the Long Term Support version of Forgejo.forgejoandforgejo-ltsno longer support the opt-in feature PAM (Pluggable Authentication Module).giteano longer supports the opt-in feature PAM (Pluggable Authentication Module).vuzewas removed because it is unmaintained upstream and insecure (CVE-2018-13417). BiglyBT is a maintained fork.services.ddclient.usehas been deprecated:ddclientnow supports separate IPv4 and IPv6 configuration. Useservices.ddclient.usev4andservices.ddclient.usev6instead.services.pgbouncersystemd service is now configured withType=notify-reloadand allows reloading configuration without process restart. PgBouncer configuration options were moved to the freeform type option underservices.pgbouncer.settings.Docear was removed because it was unmaintained upstream. JabRef, Zotero, or Mendeley are potential replacements.
nodePackages.coc-metalswas removed due to being deprecated upstream.vimPlugins.nvim-metalsis its official replacement.matrix-sliding-syncwas removed because it has been replaced by the simplified sliding sync functionality introduced in matrix-synapse 114.0.nodePackages.coc-tslint,vimPlugins.coc-tslint,nodePackages.coc-tslint-plugin, andvimPlugins.coc-tslint-pluginwere removed due to being deprecated upstream. ThenodePackages.coc-eslintandvimPlugins.coc-eslintpackages offer comparable features foreslint, which replacedtslint.Tcl packages have been moved into the
tclPackagesscope.teleporthas been upgraded from major version 15 to major version 16. Refer to upstream upgrade instructions and release notes for v16.tests.overriding’spassthru.testshas been restructured as an attribute set instead of a list, making individual tests accessible by their names.skk-dictwas split into multiple packages underskkDictionaries. If in doubt of what to use, tryskkDictionaries.l. As part of this change, the dictionaries were moved from$out/shareto$out/share/skk. The dictionaries also won’t be converted to UTF-8 unless theuseUtf8package option is enabled; UTF-8 converted dictionaries will have the .utf8 suffix appended to its filename.vaultwardenlost the capability to bind to privileged ports. If you rely on this behavior, override the systemd unit to allowCAP_NET_BIND_SERVICEin your configuration.services.invoiceplane.sites.<name>.extraConfigwas removed. Configuration must now be done through the structuredservices.invoiceplane.sites.<name>.settingsoption.services.ollama.sandboxhas been replaced with options to configure a staticuserandgroup. ThewritablePathsoption has also been removed and the models directory is now always exempt from sandboxing.The
gns3-serverservice now runs under thegns3system user instead of a dynamically created one viaDynamicUser. The use of SUID wrappers is incompatible with SystemD’sDynamicUsersetting, and GNS3 requires calling ubridge through its SUID wrapper to function properly. This change requires to manually move the following directories:from
/var/lib/private/gns3to/var/lib/gns3from
/var/log/private/gns3to/var/log/gns3and to change the ownership of these directories and their contents togns3(including/etc/gns3).
Legacy package
stalwart-mail_0_6was dropped, please note the manual upgrade process before changing the package topkgs.stalwart-mailinservices.stalwart-mail.package.nomad_1_5andnomad_1_6were dropped, as they have reached end-of-life upstream. Evaluating them will throw an error.The default
nomadpackage has been updated to 1.8.x. For more information, see breaking changes for Nomad 1.8androidndkPkgshas been updated toandroidndkPkgs_26.Android NDK version 26 and SDK version 33 are now the default versions used for cross compilation to android.
ankisyncdpackage and itsservices.ankisyncdhave been removed. Useservices.anki-sync-serverinstead.nodePackages.vscode-css-languageserver-bin,nodePackages.vscode-html-languageserver-bin, andnodePackages.vscode-json-languageserver-binwere dropped due to an unmaintained upstream. Thevscode-langservers-extractedpackage is a maintained drop-in replacement.nodePackages.prismahas been replaced byprisma.fetchNextcloudApphas been rewritten to usefetchurlrather thanfetchzip. This invalidates all existing hashes, but you can restore the old behavior by passing itunpack = true.haskell.lib.compose.justStaticExecutablesnow disallows references to GHC in its output by default to alert users to closure size issues caused by #164630. See “Packaging Helpers” in the Haskell section of the Nixpkgs manual for information on working aroundoutput '...' is not allowed to refer to the following pathserrors caused by this change.services.stalwart-mailnow runs under thestalwart-mailsystem user instead of a dynamic one viaDynamicUserin order to avoid automatic ownership changes on its large file store on service restart. This change requires to manually move the state directory from/var/lib/private/stalwart-mailto/var/lib/stalwart-mail, and to change the ownership of the directory and its content tostalwart-mail.services.stalwart-mailnow uses RocksDB as the default storage backend forstateVersion≥ 24.11. It was previously using SQLite for structured data and the filesystem for blobs.services.stargazerhas been hardened to improve security, but these changes make break certain setups, particularly around traditional CGI.services.stargazer.allowCgiUserhas been added, enabling Stargazer’scgi-useroption to work, which was previously broken.
services.shiorinow requires the HTTP secret valueSHIORI_HTTP_SECRET_KEYto be provided as an environment variable.services.shiori.environmentFilehas been introduced to handle this:# This is how a environment file can be generated: # $ printf "SHIORI_HTTP_SECRET_KEY=%s\n" "$(openssl rand -hex 16)" > /path/to/env-file services.shiori.environmentFile = "/path/to/env-file";/share/nanois now only linked whenprograms.nano.enableis enabled.PPD files for Utax printers were renamed (spaces replaced by underscores) in the newest
foomatic-dbpackage. Users of Utax printers might need to adapt theirhardware.printers.ensurePrinters.*.modelvalue to account for this.sqldeveloperwas dropped due to being severely out-of-date and having a dependency on JavaFX for Java 8, which we do not support.The
kvdokernel module package was removed as it was upstreamed in kernel version 6.9, where it is now calleddm-vdo.libe57formathas been updated to>= 3.0.0, which contains some backward-incompatible API changes. See the release note for more details.gitlabdeprecated support for runner registration tokens in GitLab 16.0, disabled their support in GitLab 17.0 and will ultimately remove it in GitLab 18.0 (as outlined in the documentation). After upgrading to GitLab >= 17.0, it is possible to re-enable support for registration tokens in the UI until GitLab 18.0. Refer to the manual on using registration tokens after GitLab 17.0. GitLab administrators should migrate to the new runner registration workflow with runner authentication tokens until the release of GitLab 18.0.gitlabhas been updated from 16.x to 17.x and requirespostgresql>= 14.9, as stated in the documentation. Check the upgrade guide in the NixOS manual on how to upgrade your PostgreSQL installation.gitaly(part ofgitlab) is now using the bundledgitpackage instead ofpkgs.git, to maintain compatibility with GitLab.nixos/gitlabno longer addspkgs.gittoenvironment.systemPackagesby default.The
replay-sorcerypackage and module was removed as it unmaintained upstream. Consider usinggpu-screen-recorderorobs-studioinstead.A few options of
services.sambahave been moved fromextraConfigandconfigTextto the new freeform optionsettingsand renamed, e.g.:services.samba.invalidUserstoservices.samba.settings.global."invalid users"services.samba.securityTypetoservices.samba.settings.global."security type"services.samba.sharestoservices.samba.settingsservices.samba.enableWinbinddtoservices.samba.winbindd.enableservices.samba.enableNmbdtoservices.samba.nmbd.enable
zxwas updated to v8, which introduces several breaking changes. See the v8 changelog for more information.feishinremoved support for Navidrome< v0.53.2due to an API change. See the v0.10.0 release notes for more information.services.dnscrypt-wrapperwas removed, as the project has been effectively unmaintained since 2018. Moreover, the NixOS module had to rely on an abandoned version ofdnscrypt-proxyv1 for the rotation of keys. To wrap a resolver with DNSCrypt, you can instead usednsdist. Seeservices.dnsdist.dnscryptThe
portunuspackage and service do not support weak password hashes anymore. If you installed Portunus on NixOS 23.11 or earlier, upgrade to NixOS 24.05 first to get support for strong password hashing. Then, follow the instructions on the upstream release notes to upgrade all existing user accounts to strong password hashes. If you need to upgrade to 24.11 without having completed the migration, consider the security implications of weak password hashes on your user accounts, and add the following to your configuration:{ services.portunus.package = pkgs.portunus.override { libxcrypt = pkgs.libxcrypt-legacy; }; services.portunus.ldap.package = pkgs.openldap.override { libxcrypt = pkgs.libxcrypt-legacy; }; }The default value of
services.kubernetes.kubelet.hostnameis now lowercased. Explicitly setkubelet.hostnametonetworking.fqdnOrHostNameto get back the old default behavior.Docker now defaults to 27.x, as version 24.x stopped receiving security updates and bug fixes after February 1, 2024.
keycloakwas updated to version 25, which introduces new hostname related options. See Upgrading Guide for instructions.programs.vim.defaultEditornow only works ifprograms.vim.enableis enabled.services.mautrix-metawas updated to 0.4. This release makes significant changes to the settings format. If you have custom settings you should migrate them to the new format. Unfortunately upstream provides little guidance for how to do this, but the auto-migration code may serve as a useful reference. The NixOS module should warn you if you still have any old settings configured.The
nodePackages.shoutpackage has been removed because it was deprecated upstream in favor ofthelounge. Theshouttop-level attribute was an alias to this package. The associatedservices.shoutmodule has also been removed.prometheus-openldap-exporterwas removed, as it was unmaintained both upstream and in nixpkgs.The
indi-fullpackage no longer contains non-free drivers. To get the old collection of drivers useindi-full-nonfreeor create your own collection of drivers by overriding indi-with-drivers. E.g.:pkgs.indi-with-drivers.override {extraDrivers = with pkgs.indi-3rdparty; [indi-gphoto];}/share/vim-pluginsnow only gets linked ifprograms.vim.enableis enabledThe
services.guixmodule now manages trusted substitute servers declaratively. Instead ofguix archive --authorize, list keys withservices.guix.substituters.authorizedKeys. Default substitute servers can be set viaservices.guix.substituters.urls.The
tracypackage no longer works on X11, since it’s moved to Wayland support, which is the intended default behavior by Tracy maintainers. X11 users have to switch to the new packagetracy-x11.gollumhas been upgraded to major version 6. Please review their migration notes.services.prometheus.exporters.miniooption has been removed, as it’s upstream implementation was broken and unmaintained. Minio now has built-in Prometheus metrics exposure, which can be used instead.The
services.prometheus.exporters.toroption has been removed, as its upstream implementation was broken and unmaintained.services.patroni.rafthas been removed, as Raft has been deprecated by upstream since 3.0.0.The
jd-clipackage was removed due to an inactive upstream and a dependency on the shut down JCenter JAR repository. Java decompilers already packaged in Nixpkgs includebytecode-viewer(GUI),cfr(CLI), andprocyon(CLI).The
jd-guipackage was removed due to an inactive upstream and a dependency on the end-of-life Gradle 6. Java decompilers already packaged in Nixpkgs includebytecode-viewer(GUI),cfr(CLI), andprocyon(CLI).services.roundcube.maxAttachmentSizewill multiply the value set with1.37to offset overhead introduced by the base64 encoding applied to attachments.services.mxisdhas been removed as both mxisd and ma1sd are no longer maintained. Consequently, the packagema1sdhas also been removed.The
rss-bridgeservice drops the support to load a configuration file from${config.services.rss-bridge.dataDir}/config.ini.php. Consider using theservices.rss-bridge.configoption instead.mikutterhas been removed, as the package was broken and had no maintainers in nixpkgs.xdg.portal.gtkUsePortalhas been removed, as it had been deprecated for over 2 years. Using theGTK_USE_PORTALenvironment variable in this manner is not intended nor encouraged by the GTK developers, but can still be done manually viaenvironment.sessionVariables.Support for the legacy CUPS browsing and LDAP have been removed from
services.printing. Ifcupsorldapare in theBrowseRemoteProtocolssetting inservices.printing.browsedConf, it needs to be removed.services.trust-dnshas been renamed toservices.hickory-dns.services.prometheus.exporters.pgbouncer.connectionStringFilehas been removed since it leaked the connection string (and thus potentially the DB password) into the cmdline of process making it effectively world-readable.Use
services.prometheus.exporters.pgbouncer.connectionEnvFileinstead.lshandservices.lshdhave been removed as they had no maintainer in Nixpkgs and no upstream release in over a decade. It is recommended to migrate toopensshandservices.openssh.cephhas been upgraded to v19. See the Ceph “squid” release notes for details and recommended upgrade procedure.services.frrhas been refactored to use upstream service scripts. The per-daemon configurations have been removed in favour of anintegrated-vtysh-configstyle config. The daemon submodules now use the daemon name (e.g.ospfd) instead of the protocol name (ospf). The daemonszebra,mgmtdandstaticdare always enabled if a config is present. ThevtyListenAddressandvtyListenPortoptions have been removed; useoptionsorextraOptionsinstead, respectively.opencv2andopencv3have been removed, as they are obsolete and were not used by any other package. External users are encouraged to migrate to OpenCV 4.tvheadendpackage and theservices.tvheadendmodule have been removed due to lack of maintenance in Nixpkgs and being stuck on an unmaintained version that required FFmpeg 4. Please see the related pull request #332259 if you are interested in maintaining a newer version.antennasandservices.antennashave been removed as they only work withtvheadend(see above).system.build.brightboxImagehas been removed as it no longer built and has not seen any maintenance in over 7 years (excluding tree-wide changes).services.syncplaynow exposes all currently available command-line arguments forsyncplay-serveras options, as well as auseACMEHostoption for easy TLS setup. The systemd service now usesDynamicUser/StateDirectoryand theuserandgroupoptions have been deprecated.openlenswas removed. It is recommended to uselens-desktopinstead.services.dnsmasq.extraConfighas been removed, as it had been deprecated for over 2 years. This option has been replaced byservices.dnsmasq.settings.The NixOS installation media no longer support the ReiserFS or JFS file systems by default.
Minimal installer ISOs are no longer built on the small channel. Please obtain installer images from the full release channels.
The default FFmpeg version is now 7.1, and FFmpeg 5 has been removed. Please prefer using the package variants without a version suffix, or pin FFmpeg 6 or 4 if necessary for compatibility. Note that we keep old versions around only as required to support packages in the tree, and FFmpeg 4 especially should be avoided in favour of newer versions as it may be removed soon.
opensslnow defaults to the latest version line3.3.x, instead of3.0.xbefore. While there should be no major code incompatibilities, newer OpenSSL versions typically strengthen the default security level. This means that you may have to explicitly allow weak ciphers, hashes and key lengths if necessary. See: OpenSSL security level documentation.isynchas been updated to version1.5.0, which introduces some breaking changes. See the compatibility concerns for more details.Two new packages –
gpauthandgpclientfrom the 2.x version of the GlobalProtect-openconnect project – are added in parallel toglobalprotect-openconnect. The GUI components related to the project are non-free and not packaged.Compatible string matching for
hardware.deviceTree.overlayshas been changed to a more correct behavior. See below for details.rusticwas upgraded to0.9.0, which contains breaking changes to the config file format.pkgs.formats.iniandpkgs.formats.iniWithGlobalSectionwithlistsAsDuplicateKeysorlistToValueno longer merge non-list values into lists by default. Backwards-compatible behavior can be enabled withatomsCoercedToLists.Atlassian Server products have been removed, as support for the Atlassian Server products ended in February 2024 and there was insufficient interest in maintaining the Atlassian Data Center replacements:
The
atlassian-bamboopackageThe
atlassian-confluencepackage and itsservices.confluenceNixOS moduleThe
atlassian-crowdpackage and itsservices.crowdNixOS moduleThe
atlassian-jirapackage and itsservices.jiraNixOS module
python3Packages.nosehas been removed, as it has been deprecated and unmaintained for almost a decade and does not work on Python 3.12. Please switch topytestor another test runner/framework.dotnet-sdk,dotnet-runtime, and all other dotnet packages now use a wrapper package containingbin/dotnet, build hooks, etc. If you need to reference the underlying dotnet distribution (DOTNET_ROOT) you should use e.g.dotnet-runtime.unwrapped.The root of dotnet distribution packages (DOTNET_ROOT) is now under e.g.
${dotnet-sdk.unwrapped}/share/dotnetinstead of directly in the package root. This is consistent with packaging guidelines and more friendly for FHS environments.dotnet-sdk,dotnet-runtime, anddotnet-aspnetcorenow point to dotnet 8 rather than dotnet 6. For packages that still need dotnet 6, usedotnet-sdk_6, etc.torq has been removed because upstreamed went closed source.
Other Notable Changes
The
zerocallusedregshardening flag is enabled by default on compilers that support it.The
stackclashprotectionhardening flag has been added, though disabled by default.The
pacrethardening flag has been added, though disabled by default.cargoSha256inrustPlatform.buildRustPackagehas been deprecated in favor ofcargoHashwhich supports SRI hashes. See buildRustPackage: Compiling Rust applications with Cargo for more information.The
vendorHashof Go packages built withbuildGoModulecan now be overridden withoverrideAttrs.goModules,modRoot,vendorHash,deleteVendor, andproxyVendorare now passed as derivation attributes.goModulesandvendorHashare no longer placed underpassthru.buildFlags/buildFlagsArrayonbuildGoModulehave been deprecated. 24.11 is the last release wherebuildGoModuleaccepts these flags (while throwing a warning). Use theldflagsand/ortagsattributes or the environment instead.buildGoPackagehas been deprecated. 24.11 is the last release withbuildGoPackageavailable.hareHookhas been added as the language framework for Hare. From now on, it, not theharepackage, should be added tonativeBuildInputswhen building Hare programs.virtualisation.docker.liveRestorehas been renamed tovirtualisation.docker.daemon.settings."live-restore"and turned off by default for state versions of at least 24.11.Tailscale’s
authKeyFilecan now have its corresponding parameters set throughconfig.services.tailscale.authKeyParameters, allowing for non-ephemeral unsupervised deployment and more. See Registering new nodes using OAuth credentials for the supported options.nixosTestsnow provide a working IPv6 setup for VLAN 1 by default.Kanidm can now be provisioned using the new [
services.kanidm.provision] option, but requires using a patched version available viapkgs.kanidm.withSecretProvisioning.Kanidm previously had an incorrect systemd service type, causing dependent units with an
afterandrequiresdirective to start beforekanidm*finished startup. The module has now been updated in line with upstream recommendations.services.jupyteris now compatible withJupyter Notebook 7. See the migration guide for details.The kubelet configuration file can now be amended with arbitrary additional content using the
services.kubernetes.kubelet.extraConfigoption.The
services.seafilemodule was updated to major version 11.As part of this upgrade, the database backend will be migrated to MySQL. This process should be automatic, but in case of a botched migration, old sqlite files are not removed and can be used to manually migrate the database.
Additionally, the updated CSRF protection may prevent some users from logging in. Specific origin addresses can be whitelisted using the
services.seafile.seahubExtraConfoption (e.g.services.seafile.seahubExtraConf = ''CSRF_TRUSTED_ORIGINS = ["https://example.com"]'';). Note that first solution of the official FAQ answer is not allowed by theservices.nginxmodule’s config-checker.
The new option
boot.binfmt.addEmulatedSystemsToNixSandboxallows you to skip adding the emulated systems tonix.settings.extra-platforms. Now you can emulate foreign binaries locally while only building them on native remote builders.The latest available version of Nextcloud is v30 (available as
pkgs.nextcloud30). The installation logic is as follows:If
services.nextcloud.packageis specified explicitly, this package will be installed (recommended)If
system.stateVersionis >=24.05,pkgs.nextcloud29will be installed by default.If
system.stateVersionis >=24.11,pkgs.nextcloud30will be installed by default.Please note that an upgrade from v28 (or older) to v30 directly is not possible. Please upgrade to
nextcloud29(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud29;.
To facilitate dependency injection, the
imguipackage now builds a static archive using vcpkg’ CMake rules. The derivation now installs “impl” headers selectively instead of by a wildcard. Useimgui.srcif you just want to access the unpacked sources.The new
boot.loader.systemd-boot.windowsoption makes setting up dual-booting with Windows on a different drive easier.The
boot.loader.raspberryPioptions were marked as deprecated in 23.11 and have now been removed.Linux 4.19 has been removed because it will reach its end of life within the lifespan of 24.11.
Unprivileged access to the kernel syslog via
dmesgis now restricted by default. Users wanting to keep an unrestricted access to it can setboot.kernel.sysctl."kernel.dmesg_restrict" = false.The
i18n.inputMethodmodule introduces two new properties:enableandtype, for declaring whether to enable an alternative input method and defining which input method respectfully. The options available intypeare the same as the existingenabledoption.enabledis now deprecated, and will be removed in a future release.security.pam.u2fnow uses freeform options; all module options are now configurable throughsecurity.pam.u2f.settings.mikutterwas removed as the package was broken and had no maintainers.services.getty.autologinOncewas added to limit the automatic login to once per boot and on the first tty only. When using full disk encryption, this option allows to unlock the system without retyping the passphrase while keeping the other ttys protected.Gollum was upgraded to major version 6. Read their migration notes.
The hooks
yarnConfigHookandyarnBuildHookwere added. These should replaceyarn2nix.mkYarnPackageand otheryarn2nixrelated tools. The motivation to get rid ofyarn2nixtools is the fact that they are too complex and hard to maintain, and they rely upon too much Nix evaluation which is problematic if import-from-derivation is not allowed (see more details at #296856. The transition frommkYarnPackagetoyarn{Config,Build}Hookis tracked at #324246.services.timesyncd.serversnow defaults tonull, allowing systemd-timesyncd to use NTP servers advertised by DHCP.services.timesyncd.fallbackServerswas added and defaults tonetworking.timeServers.Cinnamon has been updated to 6.2. Please check upstream announcement for more details. Following Mint 22 defaults, the Cinnamon module no longer ships
gearyandhexchatby default.zfs.latestCompatibleLinuxPackagesis deprecated and is now pointing at the default kernel. If using the stable LTS kernel (defaultlinuxPackagesis not possible then you must explicitly pin a specific kernel release. For example,boot.kernelPackages = pkgs.linuxPackages_6_6. Please be aware that non-LTS kernels are likely to go EOL before ZFS supports the latest supported non-LTS release, requiring manual intervention.The
shadowstackhardening flag has been added, though disabled by default.writeReferencesToFilehas been removed after its deprecation in 24.05. Use the trivial build helperwriteClosureinstead.xxdis now provided by thetinyxxdpackage rather thanvim.xxdto reduce closure size and vulnerability impact. Since it has the same options and semantics as Vim’sxxdutility, there is no user impact. Vim’sxxdremains available as thevim.xxdpackage.resticmodule now has an option for inhibiting system sleep while backups are running, defaulting to off (not inhibiting sleep). Available asservices.restic.backups.<name>.inhibitsSleep.Mattermost has been updated from 9.5 to 9.11 ESR. See the changelog for more details.
cargo-tauri.hookwas introduced to help users build Tauri projects. It is meant to be used alongsiderustPlatform.buildRustPackageand Node hooks such asnpmConfigHook,pnpm.configHook, and the newyarnConfigpower.upsnow powers off UPSs during a power outage event. This saves UPS battery and ensures that host(s) get back up again when power comes back, even in the scenario when the UPS would have had enough capacity to keep power on during the whole power outage. If you like the old behaviour of keeping the UPSs on (and emptying the battery) after the host(s) have shut down, and risk not getting a power cycle event to get the host(s) back up, setpower.ups.upsmon.settings.POWERDOWNFLAG = null;.nixos-firewall-toolnow supports nftables in addition to iptables and is installed by default when NixOS firewall is enabled.Support for runner registration tokens has been deprecated in
gitlab-runner15.6 and is expected to be removed ingitlab-runner18.0. Configuration of existing runners should be changed to using runner authentication tokens by configuringservices.gitlab-runner.services.<name>.authenticationTokenConfigFileinstead of the formerservices.gitlab-runner.services.<name>.registrationConfigFileoption.iproute2now has libbpf support.If you use extensions that are not packaged in nixpkgs, please review whether it still works with the current settings and adjust accordingly if needed.
nix.channel.enable = falseno longer impliesnix.settings.nix-path = []. Since Nix 2.13, anix-pathset innix.confcannot be overridden by theNIX_PATHconfiguration variable.ZFS now imports its pools in
postResumeCommandsrather thanpostDeviceCommands. If you hadpostDeviceCommandsscripts that depended on ZFS pools being imported, those now need to be inpostResumeCommands.services.automatic-timezoned.enable = truewill now settime.timeZone = null. This is to avoid silently shadowing a user’s explicitly defined timezone without recognition on the user’s part.services.localtimed.enable = truewill now settime.timeZone = null. This is to avoid silently shadowing a user’s explicitly defined timezone without recognition on the user’s part.qgisandqgis-ltrare now built withoutgrassby default.grasssupport can be enabled withqgis.override { withGrass = true; }.virtualisation.incusmodule gained newincus-user.serviceandincus-user.socketsystemd units. It is now possible to add a user toincusgroup instead ofincus-adminfor increased security.buildDotnetModulenow uses JSON-based instead of nix-based lockfiles. Support for nix-based lockfiles has been deprecated and will be dropped on release 25.11.buildDotnetModule.fetch-depsnow generates a JSON lockfile by default. A nix-based lockfile will be generated if one existed before for compatibility, however it has been deprecated and will be dropped on release 25.11.freecadnow supports addons and custom configuration in nix-way, which can be used by callingfreecad.customize.buildNimSbomwas added as an alternative tobuildNimPackage.buildNimSbomuses SBOMs to generate packages whereasbuildNimPackageuses a custom JSON lockfile format.
Detailed Migration Information
sound options removal
The sound options have been largely removed, as they are unnecessary for most modern setups, and cause issues when enabled.
If you set sound.enable in your configuration:
If you are using Pulseaudio or PipeWire, simply remove that option
If you are not using an external sound server, and want volumes to be persisted across shutdowns, set
hardware.alsa.enablePersistence = trueinstead
If you set sound.enableOSSEmulation in your configuration:
Make sure it is still necessary, as very few applications actually use OSS
If necessary, set
boot.kernelModules = [ "snd_pcm_oss" ]
If you set sound.extraConfig in your configuration:
If you are using another sound server, like Pulseaudio, JACK or PipeWire, migrate your configuration to that
If you are not using an external sound server, set
environment.etc."asound.conf".text = yourExtraConfiginstead
If you set sound.mediaKeys in your configuration:
Preferably switch to handling media keys in your desktop environment/compositor
If you want to maintain the exact behavior of the option, use the following snippet
{
services.actkbd =
let
volumeStep = "1%";
in
{
enable = true;
bindings = [
# "Mute" media key
{
keys = [ 113 ];
events = [ "key" ];
command = "${alsa-utils}/bin/amixer -q set Master toggle";
}
# "Lower Volume" media key
{
keys = [ 114 ];
events = [
"key"
"rep"
];
command = "${alsa-utils}/bin/amixer -q set Master ${volumeStep}- unmute";
}
# "Raise Volume" media key
{
keys = [ 115 ];
events = [
"key"
"rep"
];
command = "${alsa-utils}/bin/amixer -q set Master ${volumeStep}+ unmute";
}
# "Mic Mute" media key
{
keys = [ 190 ];
events = [ "key" ];
command = "${alsa-utils}/bin/amixer -q set Capture toggle";
}
];
};
}
hardware.deviceTree.overlays compatible string matching
The original compatible string implementation in older NixOS versions relied on substring matching, which is incorrect for overlays with multiple compatible strings and other cases.
The new behavior is consistent with what other tools already do - the overlay is considered applicable if, and only if, any of the compatible strings in the overlay match any of the compatible strings in the DT.
To provide some examples:
Overlay compatible | DT compatible | Pre-24.11 behavior | Correct behavior | Notes |
|---|---|---|---|---|
"foo" | "foo", "bar" | match | match | Most common use case does not change |
"foo" | "foobar" | match | no match | Substrings should not be matched |
"foo bar" | "foo", "bar" | match | no match | Separators should not be matched to spaces |
"foo", "bar" | "baz", "bar" | no match | match | One compatible string matching is enough |
Note that this also allows writing overlays that explicitly apply to multiple boards.
Nixpkgs Library
Breaking changes
lib.escapeShellArgandlib.escapeShellArgs: Arguments that don’t need to be escaped won’t be anymore, which is not breaking according to the functions documentation, but it can cause breakages if used for the non-intended use cases.lib.warn msg val(and its relativeslib.warnIfandlib.warnIfNot) now requiremsgto be a string to match the behavior of the newbuiltins.warn.lib.mdDoc: Removed after deprecation in the previous release.
Additions and Improvements
New and extended interfaces:
lib.fromHexString: Convert a hexadecimal string to it’s integer representation.lib.network.ipv6.fromString: Parse an IPv6 address.lib.getLicenseFromSpdxIdOr: Get the corresponding attribute inlib.licensesfrom an SPDX ID or fall back to the given default value.lib.licensesSpdx: Mapping of SPDX ID to the attributes inlib.licenses.lib.getFirstOutput: LikegetOutputbut with a list of fallback output names.lib.getIncludeandlib.getStatic: Get a package’sinclude/staticoutput.lib.trimandlib.trimWith: Remove leading and trailing whitespace from a string.lib.meta.defaultPriority: The default priority of packages in Nix.lib.toExtension: Convert to an extending function (overlay).lib.fetchers.normalizeHash: Convert an attrset containing one ofhash,sha256orsha512into one containingoutputHash{,Algo}as accepted bymkDerivation.lib.fetchers.withNormalizedHash: Wraps a function which acceptsoutputHash{,Algo}into one which acceptshash,sha256orsha512.Various builtins are now reexported in a more standard way:
lib.map->lib.lists.map->builtins.maplib.intersectAttrs->lib.attrsets.intersectAttrs->builtins.intersectAttrslib.removeAttrs->lib.attrsets.removeAttrs->builtins.removeAttrslib.match->lib.strings.match->builtins.matchlib.split->lib.strings.split->builtins.splitlib.typeOf->builtins.typeOflib.unsafeGetAttrPos->builtins.unsafeGetAttrPos
lib.cli.toGNUCommandLinenow supports theoptionValueSeparatorargument attribute to control the key-value separator for arguments.
Documentation improvements:
Much of the documentation has been migrated to the standard doc-comment format, including
lib.derivations,lib.fixedPoints,lib.gvariant,lib.filesystem,lib.strings,lib.meta.lib.generatorsdocumentation is now improved and rendered in the manual.lib.clidocumentation is now improved and rendered in the manual.lib.composeExtensionsandlib.composeManyExtensionsdocumentation is now improved.lib.importTOMLandlib.importJSON’s documentation now have an example.
Module System:
lib.importApply: New function, imports a Nix expression file much like the module system would, after passing an extra positional argument to the function in the file.Improve error message when accessing an option that isn’t defined.
lib.types.anything: Don’t fail to merge when specifying the same list multiple times.Improve error when loading a flake as a module.
Deprecations
lib.options.mkPackageOptionMDis now obsolete; use the identicallib.options.mkPackageOptioninstead.lib.misc.mapAttrsFlattenis now formally deprecated and will be removed in future releases; use the identicallib.attrsets.mapAttrsToListinstead.lib.isInOldestRelease: Renamed tooldestSupportedReleaseIsAtLeastand deprecated.
NixOS Wiki
The official NixOS Wiki at wiki.nixos.org was launched in April 2024, featuring content initially copied from the community wiki. The wiki enhances the official documentation, linking to existing resources and providing a categorization system for easy navigation, and is guided by a new “Manual of Style” — a contribution guide and enhanced templates. It offers a wealth of new information, including articles on applications, desktop environments, and a growing number of translations in multiple languages.
Release 24.05 (“Uakari”, 2024.05/31)
Support is planned until the end of December 2024, handing over to 24.11.
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
The default kernel package has been updated from 6.1 to 6.6. All supported kernels remain available.
For each supporting version of the Linux kernel, firmware blobs are compressed with zstd. For firmware blobs this means an increase of 4.4% in size, however a significantly higher decompression speed.
NixOS now installs a stub ELF loader that prints an informative error message when users attempt to run binaries not made for NixOS.
This can be disabled through the
environment.stub-ld.enableoption.If you use
programs.nix-ld.enable, no changes are needed. The stub will be disabled automatically.
On flake-based NixOS configurations using
nixpkgs.lib.nixosSystem, NixOS will automatically setNIX_PATHand the system-wide flake registry (/etc/nix/registry.json) to point<nixpkgs>and the unqualified flake pathnixpkgsto the version of nixpkgs used to build the system.This makes
nix run nixpkgs#helloandnix-build '<nixpkgs>' -A hellowork out of the box with no added configuration, reusing dependencies already on the system.This may be undesirable if Nix commands are not going to be run on the built system since it adds nixpkgs to the system closure. For such closure-size-constrained non-interactive systems, this setting should be disabled.
To disable it, set nixpkgs.flake.setNixPath and nixpkgs.flake.setFlakeRegistry to false.
NixOS AMIs are now uploaded regularly to a new AWS Account. Instructions on how to use them can be found on https://nixos.github.io/amis. We are working on integrating the data into the NixOS homepage. The list in
nixos/modules/virtualisation/amazon-ec2-amis.nixwill stop being updated and will be removed in the future.It is now possible to have a completely perlless system (i.e. a system without perl). Previously, the NixOS activation depended on two perl scripts which can now be replaced via an opt-in mechanism. To make your system perlless, you can use the new perlless profile:
{ modulesPath, ... }: { imports = [ "${modulesPath}/profiles/perlless.nix" ]; }Cinnamon has been updated to 6.0. Please be aware that the Wayland session is still experimental in this release and could potentially affect Xorg sessions. We suggest a reboot when switching between sessions.
GNOME has been updated to 46 “Kathmandu”. Refer to the release notes for more details. Notably this release brings experimental VRR support, default GTK renderer changes and WebDAV support in Online Accounts. This release we have also stopped including the legacy and unsupported Adwaita-Dark theme by default.
Lomiri (formerly known as Unity8) desktop mode, using Mir 2.x to function as a Wayland compositor, is now available and can be installed with
services.desktopManager.lomiri.enable = true. Note that some core applications, services and indicators have yet to be packaged, and some functions may remain incomplete, but the base experience should be there.LXQt has been updated to 2.0, which is based on Qt 6 and features Wayland support for many applications.
MATE has been updated to 1.28.
To properly support panel plugins built with Wayland (in-process) support, we are introducing the
services.xserver.desktopManager.mate.extraPanelAppletsoption, please use that for installing panel applets.Similarly, please use the
services.xserver.desktopManager.mate.extraCajaExtensionsoption for installing Caja extensions.To use the Wayland session, enable
services.xserver.desktopManager.mate.enableWaylandSession. This is opt-in for now as it is in early an stage and introduces a new set of Wayfire closures. Due to known issues with LightDM, we suggest using SDDM as the display manager.
Plasma 6 is now available and can be installed with
services.desktopManager.plasma6.enable = true;. Plasma 5 will likely be deprecated in the next release (24.11). Note that Plasma 6 runs as Wayland by default, and the X11 session needs to be explicitly selected if necessary.
New Services
Anki Sync Server, the official sync server built into recent versions of Anki. Available as services.anki-sync-server. The pre-existing
services.ankisyncdhas been marked deprecated and will be dropped after 24.05 due to lack of maintenance of the ankisyncd software.ALVR, a VR desktop streamer. Available as programs.alvr.
AppImage, a tool to package desktop applications, now has a
binfmtoption to support running AppImages seamlessly on NixOS. Available as programs.appimage.binfmt.armagetronad, a mid-2000s 3D lightcycle game widely played at iD Tech Camps. You can define multiple servers using
services.armagetronad.<server>.enable.BenchExec, a framework for reliable benchmarking and resource measurement, available as programs.benchexec, as well as related programs CPU Energy Meter, available as programs.cpu-energy-meter, and PQoS Wrapper, available as
programs.pqos-wrapper.Bluemap, a 3D minecraft map renderer. Available as services.bluemap.
clatd, a CLAT / SIIT-DC Edge Relay implementation for Linux.
Clevis, a pluggable framework for automated decryption, used to unlock encrypted devices in initrd. Available as boot.initrd.clevis.enable.
CommaFeed, a Google Reader-inspired self-hosted RSS reader. Available as services.commafeed.
davis, a simple CardDav and CalDav server inspired by Baïkal. Available as services.davis.
db-rest, a wrapper around Deutsche Bahn’s internal API for public transport data. Available as services.db-rest.
dnsproxy, a simple DNS proxy with DoH, DoT, DoQ and DNSCrypt support. Available as services.dnsproxy.
FCast Receiver, an open-source alternative to Chromecast and AirPlay. Available as programs.fcast-receiver.
FileSender, a file sharing software. Available as
services.filesender.Firefly-iii, a free and open source personal finance manager. Available as services.firefly-iii.
Flarum, a delightfully simple discussion platform for your website. Available as services.flarum.
fritz-exporter, a Prometheus exporter for extracting metrics from FRITZ! devices. Available as services.prometheus.exporters.fritz.
GNS3, a network software emulator. Available as services.gns3-server.
go-camo, a secure image proxy server. Available as services.go-camo.
Guix, a functional package manager inspired by Nix. Available as services.guix.
Handheld Daemon, support for gaming handhelds like the Legion Go, ROG Ally, and GPD Win. Available as services.handheld-daemon.
hebbot, a Matrix bot to generate “This Week in X” like blog posts. Available as services.hebbot.
inadyn, a Dynamic DNS client with built-in support for multiple providers. Available as services.inadyn.
intel-gpu-tools, tools for development and testing of the Intel DRM driver. Available as hardware.intel-gpu-tools.
isolate, a sandbox for securely executing untrusted programs. Available as security.isolate.
Jottacloud Command-line Tool, a CLI for the Jottacloud cloud storage provider. Available as services.jotta-cli.
keto, a permission & access control server, the first open source implementation of Zanzibar: Google’s Consistent, Global Authorization System.
manticoresearch, easy to use open source fast database for search. Available as services.manticore.
maubot, a plugin-based Matrix bot framework. Available as services.maubot.
mautrix-meta, a Matrix <-> Facebook and Matrix <-> Instagram hybrid puppeting/relaybot bridge. Available as services.mautrix-meta.
mautrix-signal, a Matrix-Signal puppeting bridge. Available as services.mautrix-signal.
Mealie, a self-hosted recipe manager and meal planner with a RestAPI backend and a reactive frontend application built in NuxtJS for a pleasant user experience for the whole family. Available as services.mealie.
MollySocket which allows getting Signal notifications via UnifiedPush.
microsocks, a tiny, portable SOCKS5 server with very moderate resource usage. Available as services.microsocks.
Mihomo, a rule-based proxy in Go. Available as services.mihomo.enable.
Monado, an open source XR runtime. Available as services.monado.
Netbird, an open-source VPN management platform, now has a self-hosted management server. Available as services.netbird.server.
nh, yet another Nix CLI helper. Available as programs.nh.
oink, a dynamic DNS client for Porkbun. Available as services.oink.
ollama, server for running large language models locally.
nextjs-ollama-llm-ui, light-weight frontend server to chat with Ollama models through a web app.
ownCloud Infinite Scale Stack, a modern and scalable rewrite of ownCloud.
PhotonVision, a free, fast, and easy-to-use computer vision solution for the FIRST® Robotics Competition.
ping_exporter, a Prometheus exporter for ICMP echo requests. Available as services.prometheus.exporters.ping.
Pretix, an open source ticketing software for events. Available as services.pretix.
pretalx, a conference planning tool. Available as services.pretalx.
private-gpt, a service to interact with your documents using the power of LLMs, 100% privately, no data leaks.
Prometheus DNSSEC Exporter: check for validity and expiration in DNSSEC signatures and expose metrics for Prometheus. Available as services.prometheus.exporters.dnssec.
prometheus-nats-exporter, a Prometheus exporter for NATS. Available as services.prometheus.exporters.nats.
pyLoad, a FOSS download manager written in Python. Available as
services.pyload.Python Matter Server, a Matter Controller Server exposing websocket connections for use with other services, notably Home Assistant. Available as services.matter-server.
RustDesk, a full-featured open source remote control alternative for self-hosting and security with minimal configuration. Alternative to TeamViewer. Available as services.rustdesk-server.
ryzen-monitor-ng, a desktop AMD CPU power monitor and controller, similar to Ryzen Master but for Linux. Available as programs.ryzen-monitor-ng.
ryzen-smu, Linux kernel driver to expose the SMU (System Management Unit) for certain AMD Ryzen Processors. Includes the userspace program
monitor_cpu. Available at hardware.cpu.amd.ryzen-smu.Scrutiny, a S.M.A.R.T monitoring tool for hard disks with a web frontend. Available as services.scrutiny.
SimpleSAMLphp, an application written in native PHP that deals with authentication (SQL, .htpasswd, YubiKey, LDAP, PAPI, Radius). Available as
services.simplesamlphp.systemd’sgateway,upload, andremoteservices, which provide ways of sending journals across the network. Enable using services.journald.gateway, services.journald.upload, and services.journald.remote.systemd-lock-handler, a bridge between logind D-Bus events and systemd targets. Available as services.systemd-lock-handler.enable.
rspamd-trainer, script triggered by a helper which reads mails from a specific mail inbox and feeds them into rspamd for spam/ham training.
Sunshine, a self-hosted game stream host for Moonlight. Available as services.sunshine.
Suwayomi Server, a free and open source manga reader server that runs extensions built for Tachiyomi. Available as services.suwayomi-server.
TigerBeetle, a distributed financial accounting database designed for mission critical safety and performance. Available as services.tigerbeetle.
transfer-sh, a tool that supports easy and fast file sharing from the command-line. Available as services.transfer-sh.
TuxClocker, a hardware control and monitoring program. Available as programs.tuxclocker.
Uni-Sync, a synchronization tool for Lian Li Uni Controllers. Available as hardware.uni-sync.
wastebin, a pastebin server written in rust. Available as services.wastebin.
watchdogd, a system and process supervisor using watchdog timers. Available as services.watchdogd.
WiVRn, an OpenXR streaming application. Available as services.wivrn.
Workout-tracker, a workout tracking web application for personal use.
wyoming-satellite, a voice assistant satellite for Home Assistant using the Wyoming protocol. Available as services.wyoming.satellite.
xdg-terminal-exec, the proposed Default Terminal Execution Specification.
Convenience options for
amdgpu, open source driver for Radeon cards, is now available underhardware.amdgpu.ydotool, a generic command-line automation tool now has a module. Available as programs.ydotool.
your_spotify, a self hosted Spotify tracking dashboard. Available as services.your_spotify
RKE2, also known as RKE Government, is Rancher’s next-generation Kubernetes distribution. Available as services.rke2.
Backward Incompatibilities
akkomanow requires explicitly setting the base URL for uploaded media (settings."Pleroma.Upload".base_url), as well as for the media proxy if enabled (settings."Media"). This is recommended to be a separate (sub)domain to the one Akkoma is hosted at. See here for more details.appimageTools.wrapAppImagenow creates the binary at$out/bin/${pname}rather than$out/bin/${pname}-${version}, which will break downstream workarounds.apptainerandsingularitynow prioritize system-widePATHover those constructed from dependent packages when searching for third-party utilities. ThePATHto search for third-party utilities, known asdefaultPathinside Apptainer/Singularity source code, is now constructed from the following sources, ordered by their precedence:systemBinPaths, a new argument introduced to specify system-wide"/**/bin"directories.The FHS
defaultPathvalue set by Apptainer/Singularity developers, making Apptainer/Singularity work out of the box in FHS systems.defaultPathInputs, a list of packages to form the fall-backPATH.
This change is required to enable Sylabs SingularityCE (
singularity) to run images, as it requires afusermount3command with the SUID bit set.newuidmapPathandnewgidmapPatharguments are deprecated in favour ofsystemBinPaths. Their support will be removed in future releases.programs.singularity.systemBinPathsoption is introduced to specify thesystemBinPathsargument of the overridden package. It includes"/run/wrappers/bin"even if specified empty.programs.singularity.enableFakerootoption is deprecated and has no effect.--fakerootsupport is now always enabled as long asprograms.singularity.systemBinPathsis not forcefully overridden.azure-clinow has extension support. For example, to install theaks-previewextension, use{ environment.systemPackages = [ (azure-cli.withExtensions [ azure-cli.extensions.aks-preview ]) ]; }To make the
azure-cliimmutable and prevent clashes in caseazure-cliis also installed via other package managers, some configuration files were moved into the derivation. This can be disabled by overridingwithImmutableConfig = falsewhen buildingazure-cli.boot.supportedFilesystemsandboot.initrd.supportedFilesystemsare now attribute sets instead of lists. Assignment from lists as done previously is still supported, but checking whether a filesystem is enabled must now by done usingsupportedFilesystems.fs or falseinstead of usinglib.elem "fs" supportedFilesystemsas was done previously.buildGoModulenow throws an error whenvendorHashis not specified.vendorSha256, deprecated in Nixpkgs 23.11, is now ignored and is no longer avendorHashalias.chromiumandungoogled-chromiumhad a long-standing issue regarding Widevine DRM handling in nixpkgs fixed.chromiumnow no longer automatically downloads Widevine when encountering DRM protected content. To be able to play DRM protected content inchromium, you now have to explicitly opt-in as originally intended usingchromium.override { enableWideVine = true; }. This override was added almost 10 years ago.craftos-pcpackage has been updated to v2.8, which includes breaking changes.Files are now handled in binary mode; this could break programs with embedded UTF-8 characters.
The ROM was updated to match ComputerCraft version v1.109.2.
The bundled Lua was updated to Lua v5.2, which includes breaking changes. See the Lua manual for more information.
The WebSocket API was rewritten, which introduced breaking changes.
cryptsetuphas been upgraded from 2.6.1 to 2.7.0. Cryptsetup is a critical component enabling LUKS-based (but not only) full disk encryption. Take the time to review the release notes. One of the highlights is that it is now possible to use hardware OPAL-based encryption of your disk withcryptsetup. It has a lot of caveats, see the above notes for the full details.crystalpackage has been updated to 1.11.x, which has some breaking changes. Refer to crystal’s changelog for more information. (v1.10, v1.11)cudaPackagespackage scope has been updated tocudaPackages_12.cudaPackages.autoAddOpenGLRunpathHookandcudaPackages.autoAddDriverRunpathhave been deprecated forpkgs.autoAddDriverRunpath. Functionality has not changed, but the setuphook has been renamed and moved to the top-level package scope.cudaPackages.cudatoolkithas been deprecated and replaced with a symlink-based wrapper for the splayed redistributable CUDA packages. The wrapper only includes tools and libraries necessary to build common packages such as tensorflow. The original runfile-basedcudatoolkitis still available ascudatoolkit-legacy-runfile.cudaPackages.nsight_systemsnow has most vendored third-party libraries removed, though we now only ship it forcudaPackages_11_8and later, due to outdated dependencies. Users comfortable with the vendored dependencies may useoverrideAttrsto amend thepostPatchphase and themeta.brokencorrespondingly. Alternatively, one could package the deprecatedboost170locally, as required forcudaPackages_11_4.nsight_systems.cudaPackages.autoFixElfFileshas been deprecated forpkgs.autoFixElfFiles. Functionality has not changed, but the setuphook has been renamed and moved to the top-level package scope.davfs2’sservices.davfs2.extraConfigsetting has been deprecated and converted to the free-form type option namedservices.davfs2.settingsaccording to RFC42.dwarf-fortresshas been updated to version 50, which is identical to the version on Steam, but without the paid elements like tilepacks. dfhack and Dwarf Therapist still work, and older versions are still packaged in case you’d like to roll back. Note that DF 50 saves will not be compatible with DF 0.47 and earlier. See Bay 12 Games for more details on what’s new in Dwarf Fortress.Running an earlier version can be achieved through an override:
dwarf-fortress-packages.dwarf-fortress-full.override { dfVersion = "0.47.5"; }Ruby plugin support has been disabled in DFHack. Many of the Ruby plugins have been converted to Lua, and support was removed upstream due to frequent crashes.
erlang-lspackage no longer ships theels_dapbinary as of v0.51.0.erlang_node_short_name,erlang_node_name:portandoptionsconfiguration parameters are gone, and have been replaced with anenvironmentparameter. Use the appropriate environment variables insideenvironmentto configure the service instead.firefox-devedition,firefox-beta,firefox-esrexecutable file names for now match their package names, which is consistent with thefirefox-*-binpackages. The desktop entries are also updated so that you can have multiple editions of firefox in your app launcher.gaugenow supports installing plugins using Nix. For the old imperative approach, switch togauge-unwrapped. You can load plugins from an existing gauge manifest file usinggauge.fromManifest ./path/to/manifest.jsonor specify plugins in Nix usinggauge.withPlugins (p: with p; [ js html-report xml-report ]).giteahas been updated to 1.21, which introduces several breaking changes, including:Custom themes and other assets that were previously stored in
custom/public/*now belong incustom/public/assets/*New instances of Gitea using MySQL now ignore the
[database].CHARSETconfig option and always use theutf8mb4charset, existing instances should migrate via thegitea doctor convertCLI command.
git-townwas updated from version 11 to 13. See the changelog for breaking changes.gonichas been updated to v0.16.4. Config now requiresplaylists-pathto be set. See the rest of the v0.16.0 release notes for more details.go-ethereumhas been updated to v1.14.3. Geth v1.14.0 introduced a brand new live-tracing feature, which required a number of breaking internal API changes. If you had your own native tracers implemented before this change, the changelog contains the necessary steps needed to update your old code for the new APIs. Geth v1.14.0 drops support for running pre-merge networks (#29169). It also stops automatically constructing the pending block (#28623), removes support for filtering pending logs, switched to using Go v1.22 by default (#28946), which means we’ve dropped support for Go v1.20. See the 1.14.0 release notes for more details.grafana-lokihas been updated to 3.0.0, which includes breaking changes.gtestpackage has been updated past v1.13.0, which requires C++14 or higher.haremay now be cross-compiled. For that to work, however,haredocneeded to stop being built together with it. Thus, the latter is now its own package with the name ofharedoc.himalayahas been updated to v1.0.0-beta.4, which introduces breaking changes. Check out the release note for details.halloyhas been updated to 2024.5, which introduced a breaking change by switching the config format from YAML to TOML. See https://github.com/squidowl/halloy/releases/tag/2024.5 for details.hvmwas updated to version 2.icuno longer includesinstall-shandmkinstalldirsin the shared folder.idris2was updated to v0.7.0. This version introduces breaking changes. Check out the changelog for details.inetutilsnow has a lower priority to avoid shadowing the commonly-usedutil-linux. If one wishes to restore the default priority, simply uselib.setPrio 5 inetutilsor override withmeta.priority = 5.jdt-language-serverpackage now uses upstream’s provided python wrapper instead of our own custom wrapper. This results in the following breaking and notable changes:The main binary for the package is now named
jdtlsinstead ofjdt-language-server, equivalent to what most editors expect the binary to be named.JVM arguments should now be provided with the
--jvm-argflag instead of settingJAVA_OPTS.The
-datapath is no longer required to run the package, and will be set to point to a folder in$TMPif missing.
juliaenvironments can now be built with arbitrary packages from the ecosystem using the.withPackagesfunction. For example:julia.withPackages ["Plots"].k3shas been updated to version v1.30, previous supported versions are available under release-specific names (e.g. k3s_1_27, k3s_1_28, and k3s_1_29) in order to help you migrate to the latest supported version. See changelog and upgrade notes for more information.k9swas updated to v0.31. There have been various breaking changes in the config file format, check out the changelog of v0.29, v0.30 and v0.31 for details. It is recommended to back up your current configuration and let k9s recreate the new base configuration.kanatapackage has been updated to v1.6.1, which includes breaking changes. Check out the changelog of v1.5.0 and v1.6.0 for details.linuxPackages_testing_bcachefsis now fully deprecated bylinuxPackages_latest, and is therefore no longer available.livebookpackage is now built as amix releaseinstead of anescript. This means that configuration now has to be done using environment variables instead of command line arguments. This has the further consequence that thelivebookservice configuration has changed.luainterpreters default LUA_PATH and LUA_CPATH are not overridden by nixpkgs anymore, we patch LUA_ROOT instead which is more respectful to upstream.luarocks-packages-updater’s .csv format, used to define lua packages to be updated, has changed:src(URL of a git repository) has now becomerockspec(URL of a rockspec) to remove ambiguity regarding which rockspec to use and simplify implementation.mkosiwas updated to v22. Parts of the user interface have changed. Consult the release notes of v19, v20, v21 and v22 for a list of changes.mongodb-4_4has been removed as it has reached end of life. Consequently,unifi7andunifi8now use MongoDB 5.0 by default.mongodb-5_0and newer requires a cpu with the AVX instruction set to run.neo4jhas been updated to version 5. You may want to read the release notes for Neo4j 5.netboxwas updated to v3.7.services.netbox.packagestill defaults to v3.6 ifstateVersionis earlier than 24.05. Refer to upstream’s breaking changes for v3.7.0 and upgrade NetBox by changingservices.netbox.package. Database migrations will be run automatically.network-interfaces.targetsystem target was removed as it has been deprecated for a long time. Usenetwork.targetinstead.networking.iproute2.enablenow does not setenvironment.etc."iproute2/rt_tables".text.Setting
environment.etc."iproute2/{CONFIG_FILE_NAME}".textwill override the whole configuration file instead of appending it to the upstream configuration file.CONFIG_FILE_NAMEincludesbpf_pinning,ematch_map,group,nl_protos,rt_dsfield,rt_protos,rt_realms,rt_scopes, andrt_tables.nextcloud26has been removed since it’s not maintained anymore by upstream. The latest available version of Nextcloud is now v29 (available aspkgs.nextcloud29). The installation logic is as follows:If
services.nextcloud.packageis specified explicitly, this package will be installed (recommended).If
system.stateVersionis >=24.05,pkgs.nextcloud29will be installed by default.If
system.stateVersionis >=23.11,pkgs.nextcloud27will be installed by default.Please note that an upgrade from v27 (or older) to v29 directly is not possible. Please upgrade to
nextcloud28(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud28;.Known warnings after the upgrade are documented in the section called “Known warnings” from now on.
The “Photos” app only displays Media from inside the
Photosdirectory. This can be changed manually in the “Photos” tab below “Photos settings”.
nitterrequires aguest_accounts.jsonlto be provided as a path or loaded into the default location at/var/lib/nitter/guest_accounts.jsonl. See Guest Account Branch Deployment for details.nixVersions.unstablewas removed. Instead the following attributes are provided:nixVersions.gitwhich tracks the latest Nix master and is roughly updated once a week. This is intended to enable people to easily test unreleased changes of Nix to catch regressions earlier.nixVersions.latestwhich points to the latest Nix version packaged in nixpkgs.
nomadhas been updated - note that HashiCorp recommends updating one minor version at a time. Please check their upgrade guide for information on safely updating clusters and potential breaking changes.nomadis now Nomad 1.7.x.nomad_1_4has been removed, as it is now unsupported upstream.
nvtopfamily of packages was reorganized into a nested attrset.nvtophas been renamed tonvtopPackages.full, and allnvtop-{amd,nvidia,intel,msm}packages are renamed tonvtopPackages.{amd,nvidia,intel,msm}.openssh,openssh_hpnandopenssh_gssapiare now compiled without support for the DSA signature algorithm as it is being deprecated upstream. Users still relying on DSA keys should consider upgrading to another signature algorithm. However, for the time being it is possible to restore DSA key support usingoverrideto setdsaKeysSupport = true.optparse-bashis now dropped due to upstream inactivity. Alternatives available in Nixpkgs includeargc,argbash,bashlyandgum, to name a few.paperless’services.paperless.extraConfigsetting has been removed and converted to the free-form type and option namedservices.paperless.settings.pdnswas updated to version v4.9.x, which introduces breaking changes. Check out the Upgrade Notes for details.percona-servernow follows the same two-fold release cycle as Oracle MySQL and provides a Long-Term-Support (LTS) in parallel with a continuous-delivery Innovation release.percona-serverdefaults topercona-server_lts, will be backed by the same release branch throughout the lifetime of this stable NixOS release, and is still available under the versioned attributepercona-server_8_0. Thepercona-server_innovationreleases however have support periods shorter than the lifetime of this NixOS release and will continuously be updated to newer Percona releases. Note that Oracle considers the Innovation releases to be production-grade, but each release might include backwards-incompatible changes, even in its on-disk format. The same release scheme is applied to the supportingpercona-xtrabackuptool as well.pipewireandwireplumbermodules have removed support for usingenvironment.etc."pipewire/..."andenvironment.etc."wireplumber/...". Useservices.pipewire.extraConfigorservices.pipewire.configPackagesfor PipeWire andservices.pipewire.wireplumber.configPackagesfor WirePlumber instead.power.upsnow generatesupsd.conf,upsd.usersandupsmon.confautomatically from a set of new configuration options. This breaks compatibility with existingpower.upssetups where these files were created manually. Back up these files before upgrading NixOS.programs.nix-ld.librariesno longer setsbaseLibrariesvia the option’s default but in config and now merges any additional libraries with the default ones. This means thatlib.mkForcemust be used to clear the list of default libraries.screen’s module has been cleaned, and will now require you to setprograms.screen.enablein order to populatescreenrcand add the program to the environment.security.acme.defaults.servernow has a default value instead ofnull. This effectively uses the same server, the Let’s Encrypt production server, but makes the default explicit, instead of relying on the Lego default.A side effect of this is that the directory in which account data is stored changes and the ACME module will request a new account and new certificates for all domains. This may cause issues if you pin an
acccounturlin a CAA DNS record. To avoid this, you may setsecurity.acme.defaults.server = nullto keep the old hashes.security.pam.sshAgentAuth.enablenow requiresservices.openssh.authorizedKeysFilesto be non-empty, which is the case whenservices.openssh.enableis true. Previously,pam_ssh_agent_authsilently failed to work.security.pam.enableSSHAgentAuthwas replaced by thesshAgentAuthattrset, and onlyauthorized_keysfiles listed insshAgentAuth.authorizedKeysFilesare trusted, defaulting to/etc/ssh/authorized_keys.d/%u.Warning
Users of pam_ssh_agent_auth(8) must take care that the pubkeys they use (for instance with
sudo) are listed insshAgentAuth.authorizedKeysFiles.Note
Previously, all
services.openssh.authorizedKeysFileswere trusted, including~/.ssh/authorized_keys, which results in an insecure configuration; see #31611.
services.archisteamfarmno longer uses the abbreviationasffor its state directory (/var/lib/asf), user and group (bothasf). Instead the long namearchisteamfarmis used. Configurations withsystem.stateVersion23.11 or earlier, default to the old stateDirectory until the 24.11 release and must either set the option explicitly or move the data to the new directory.frrwas updated to 10.0, which introduces the default ofenforce-first-asfor BGP. Please disable again if needed.services.aria2.rpcSecrethas been replaced withservices.aria2.rpcSecretFile. This was done so that secrets aren’t stored in the world-readable Nix store. To migrate, you will have to create a file with the same exact string, and change your module options to point to that file. For example,services.aria2.rpcSecret = "mysecret"becomesservices.aria2.rpcSecretFile = "/path/to/secret_file"where the filesecret_filecontains the stringmysecret.services.avahi.nssmdnswas split intoservices.avahi.nssmdns4andservices.avahi.nssmdns6which enable the mDNS NSS switches for IPv4 and IPv6 respectively. Since most mDNS responders only register IPv4 addresses, most users want to keep the IPv6 support disabled to avoid long timeouts.services.frp.settingsnow generates the frp configuration file in TOML format as recommended by upstream, instead of the legacy INI format. This has also introduced other changes in the configuration file structure and options:The
settings.commonsection in the configuration is no longer valid and all the options form inside it now go directly undersettings.Configuration option names have been changed from snake_case to camelCase. For example:
server_addrbecomesserverAddr,server_portbecomesserverPortetc.Proxies are now defined with a new option,
settings.proxies, which takes a list of proxies.Consult the upstream documentation for more details on the changes.
services.hledger-web.capabilitiesoptions has been replaced by a new optionservices.hledger-web.allow.allow = "view"meanscapabilities = { view = true; };allow = "add"meanscapabilities = { view = true; add = true; };allow = "edit"meanscapabilities = { view = true; add = true; edit = true };allow = "sandstorm"reads permissions from theX-Sandstorm-Permissionsrequest header.
services.homepage-dashboardnow takes its configuration using native Nix expressions, rather than dumping templated configurations into/var/lib/homepage-dashboardwhere they were previously managed manually. There are now new options which allow the configuration of bookmarks, services, widgets and custom CSS/JS natively in Nix.services.invidious.settings.db.user, the default database username has changed fromkemaltoinvidious. Setups involving an externally-provisioned database (i.e.services.invidious.database.createLocally == false) should adjust their configuration accordingly. The oldkemaluser will not be removed automatically even when the database is provisioned automatically.(https://github.com/NixOS/nixpkgs/pull/265857).services.oauth2_proxywas renamed toservices.oauth2-proxy. Also the corresponding service, user and group were renamed.services.smokepingnow has an optionwebService. When enabled, smokeping is now served via nginx instead of thttpd. This change brings the following consequences:The default port for smokeping is now the nginx default port 80 instead of 8081.
The option
services.smokeping.porthas been removed. To customize the port, useservices.nginx.virtualHosts.smokeping.listen.*.port.
services.neo4j.allowUpgradewas removed and no longer has any effect. Neo4j 5 supports automatic rolling upgrades.services.nextcloudhas the following options moved intoservices.nextcloud.settingsand renamed to match the name from Nextcloud’sconfig.php:logLevel->loglevel,logType->log_type,defaultPhoneRegion->default_phone_region,overwriteProtocol->overwriteprotocol,skeletonDirectory->skeletondirectory,globalProfiles->profile.enabled,extraTrustedDomains->trusted_domainsandtrustedProxies->trusted_proxies.
services.nginxwill no longer advertise HTTP/3 availability automatically. This must now be manually added, preferably to each location block. Example:{ locations."/".extraConfig = '' add_header Alt-Svc 'h3=":$server_port"; ma=86400'; ''; locations."^~ /assets/".extraConfig = '' add_header Alt-Svc 'h3=":$server_port"; ma=86400'; ''; }services.pgbouncernow has systemd support enabled and will log to journald. The default setting forservices.pgbouncer.logFileis nownullto disable logging to a separate log file.services.postgresql.ensureUsers._.ensurePermissionshas been removed as it is not declarative and is broken with newer postgresql versions. Consider usingservices.postgresql.ensureUsers.*.ensureDBOwnershipinstead or a tool that is more suited for managing the data inside a postgresql database.services.redis.vmOverCommitnow defaults totrueand no longer enforces Transparent Hugepages (THP) to be disabled. Redis only works with THP configured tomadvisewhich is the kernel’s default.services.resolved.fallbackDnscan now be used to disable the upstream fallback servers entirely by setting it to
[]to get previous behaviour of upstream defaults, set it to
nulldefault value has changed from
[]tonull, in order to preserve default behaviour
services.vikunjasystemd service now usesvikunjaas dynamic user instead ofvikunja-api. Database users might need to be changed.services.vikunja.setupNginxsetting has been removed. Users now need to set up the webserver configuration on their own with a proxy pass to the vikunja service.services.vmagentmodule deprecatesdataDir,groupandusersettings in favor of the systemd-provided CacheDirectory and DynamicUser.services.vmagent.remoteWriteUrlsetting has been renamed toservices.vmagent.remoteWrite.urland now defaults tonull.services.zope2has been removed, aszope2is unmaintained and was relying on Python 2.spark2014has been renamed tognatprove. A version ofgnatprovematching different GNAT versions is available from the differentgnatPackagessets.stalwart-mailhas been updated to v0.5.3, which includes breaking changes.system.etc.overlay.enableoption was added. If enabled,/etcis mounted via an overlayfs instead of being created by a custom perl script.system.forbiddenDependenciesRegexhas been renamed tosystem.forbiddenDependenciesRegexesand now has the type oflistOf stringinstead ofstringto accept multiple regexes.systemd.oomdmodule behavior has changed:Raise ManagedOOMMemoryPressureLimit from 50% to 80%. This should make systemd-oomd kill things less often, and fix issues like this. Reference: commit.
Remove swap policy. This helps prevent killing processes when user’s swap is small.
Expand the memory pressure policy to
system.slice,user-.slice, and all user-owned slices. Reference: commit.Rename
systemd.oomd.enableUserServicestosystemd.oomd.enableUserSlices.
systemd.sysusers.enableoption was added. If enabled, users and groups are created with systemd-sysusers instead of with a custom perl script.teleporthas been upgraded from major version 14 to major version 15. Refer to upstream upgrade instructions and release notes for v15.unifiLTS,unifi5andunifi6have been removed, as they require MongoDB versions which are end-of-life. All these versions can be upgraded tounifi7directly.unrarwas updated to v7. See changelog for more information.virtualisation.docker.enableNvidiaandvirtualisation.podman.enableNvidiaoptions are deprecated.hardware.nvidia-container-toolkit.enableshould be used instead. This option will expose GPUs on containers with the--deviceCLI option. This is supported by Docker 25, Podman 3.2.0 and Singularity 4. Any container runtime that supports the CDI specification will take advantage of this feature.virtialisation.incusnow defaults to the newly-addedincus-ltsrelease (v6.0.x). Users who wish to continue using the non-LTS release will need to setvirtualisation.incus.package = pkgs.incus. Stable release users are encouraged to stay on the LTS release as non-LTS releases will by default not be backported.woodpecker-*packages have been updated to v2 which includes breaking changes.wpaperdhas been updated to 1.0.1, which has a breaking change: previous version 0.3.0 had 2 different configuration files, one for wpaperd and one for the wallpapers. Remove the former and move the latter (wallpaper.toml) toconfig.toml.writeReferencesToFileis deprecated in favour of the new trivial build helperwriteClosure. The latter accepts a list of paths and has an unambiguous name and cleaner implementation.xfsprogswas updated to version 6.6.0, which enables reverse mapping (rmapbt) and large extent counts (nrext64) by default. Support for these features was added in kernel 4.9 and 5.19 and nrext64 was deemed stable in kernel 6.5. Format your filesystems withmkfs.xfs -i nrext64=0, if they need to be readable by GRUB2 before 2.12 or kernels older than 5.19.xxdhas been moved fromvimdefault output to its own output to reduce closure size. The canonical way to reference it across all platforms isunixtools.xxd.youtrackwas bumped to 2023.3. The update is not performed automatically, it requires manual interaction. See the YouTrack section in the manual for details.Ada packages (libraries and tools) have been moved into the
gnatPackagesscope.gnatPackagesuses the default GNAT compiler,gnat12Packagesandgnat13Packagesuse the respective matching compiler version.Paths provided as
restartTriggersandreloadTriggersfor systemd units will now be copied into the Nix store to make the behavior consistent. Previously,restartTriggers = [ ./config.txt ], if defined in a flake, would trigger a restart when any part of the flake changed; and if not defined in a flake, would never trigger a restart even if the contents ofconfig.txtchanged.A warning has been added for services that are
after = [ "network-online.target" ]but do not depend on it (e.g. usingwants), because the dependency thatmulti-user.targethas onnetwork-online.targetis planned for removal.switch-to-configuration does not directly call systemd-tmpfiles anymore. Instead, the new artificial sysinit-reactivation.target is introduced which allows to restart multiple services that are ordered before sysinit.target and respect the ordering between the services.
services.prometheus.exporters.snmp’s configuration format changed with release 0.23.0. The module now includes an optional config check, that is enabled by default, to make the change obvious before any deployment. More information about the configuration syntax change is available in the upstream repository.
Other Notable Changes
addDriverRunpathhas been added to facilitate the deprecation of the oldaddOpenGLRunpathsetuphook. This change is motivated by the evolution of the setuphook to include all hardware acceleration.appimage,appimageTools.wrapAppImageandbuildFHSEnvBubblewrapnow properly acceptpnameandversion.baculanow allows to configureTLSfor encrypted communication.boot.initrd.network.ssh.authorizedKeyFilesis a new option in the initrd ssh daemon module, for adding authorized keys via list of files.boot.kernel.sysctl."net.core.wmem_max"changed from a string to an integer because of the addition of a custom merge option (taking the highest value defined to avoid conflicts between 2 services trying to set that value), just asboot.kernel.sysctl."net.core.rmem_max"since 22.11.boot.loader.systemd-boot.xbootldrMountPointis a new option for setting up a separate XBOOTLDR partition to store boot files. Useful on systems with a small EFI System partition that cannot be easily repartitioned.boot.loader.systemd-bootwill now verify thatefiSysMountPoint(andxbootldrMountPointif configured) are mounted partitions.buildDubPackagecan now be used to build Programs written in D using thedubbuild system and package manager. See the D section in the manual for more information.castopodhas some migration actions to be taken in case of a S3 setup. Some new features may also need some manual migration actions. See https://code.castopod.org/adaures/castopod/-/releases for more information.documentation.man.mandocnow, by default, usesMANPATHto set the directories where mandoc will search for manual pages. This enables mandoc to find manual pages in Nix profiles. To set the manual search paths via themandoc.confconfiguration file like before, usedocumentation.man.mandoc.settings.manpathinstead.drbdout-of-tree Linux kernel driver has been added in version 9.2.7. With it the DRBD 9.x features can be used instead of the 8.x features provided by the 8.4.11 in-tree driver.garagehas been updated to v1.x.x. Users should read the upstream release notes and follow the documentation when changing over theirservices.garage.packageand performing this manual upgrade.hardware.pulseaudiomodule now sets permissions of pulse user home directory to 755 when running in systemWide mode. It fixes issue 114399.kavitahas been updated to 0.8.0, requiring a manual forced library scan on all libraries for migration. Refer to upstream’s release notes for details.krb5module has been rewritten and moved tosecurity.krb5, moving all options butsecurity.krb5.enableandsecurity.krb5.packageintosecurity.krb5.settings.libassnow uses the native CoreText backend on Darwin, which may fix subtitle rendering issues withmpv,ffmpeg, etc.libjxlversion was bumped from 0.8.2 to 0.9.1 dropped support for the butteraugli API. You will no longer be able to setenableButterauglionlibaom.lxdhas been upgraded to v5.21.x, an LTS release. The LTS release is now the only supported LXD release. Users are encouraged to migrate to Incus for better support on NixOS.matrix-synapsehomeserver module now supports configuring UNIX domain socketlistenersthrough thepathoption. The default replication worker on the main instance has been migrated away from TCP sockets to UNIX domain sockets.mockgenhas changed to the go.uber.org/mock fork because the original repository is no longer maintained.mpichnow requireswithPmto be a list, e.g."hydra:gforker"becomes[ "hydra" "gforker" ].nextcloud-setup.serviceno longer changes the group of each file and directory inside/var/lib/nextcloud/{config,data,store-apps}if one of these directories has the wrong owner group. This was part of transitioning the group used for/var/lib/nextcloud, but isn’t necessary anymore.oils-for-unix, the oil shell’s C++ version is now available. The Python version is still available asoil.pkgsExtraHardening, a new top-level package set, was added. This is a set of packages built with stricter hardening flags - those that have not yet received enough testing to be applied universally, those that are more likely to cause build failures or those that have drawbacks to their use (e.g. performance or required hardware features).portunushas been updated to major version 2. This version of Portunus supports strong password hashes, but the legacy hash SHA-256 is also still supported to ensure a smooth migration of existing user accounts. After upgrading, follow the instructions on the upstream release notes to upgrade all user accounts to strong password hashes. Support for weak password hashes will be removed in NixOS 24.11.programs.fish.packagenow allows you to override the package used in thefishmodule.qt6.qtmultimediahas changed its default backend toQT_MEDIA_BACKEND=ffmpeg(previouslygstreameron Linux ordarwinon macOS). The previous native backends remain available but are now minimally maintained. Refer to upstream documentation for further details about each platform.services.btrbknow automatically selects and provides required compression program depending on the configuredstream_compressoption.services.github-runnermodule has been removed. To configure a single GitHub Actions Runner refer toservices.github-runners.*. Note that this will trigger a new runner registration.services.networkmanager.extraConfigwas renamed toservices.networkmanager.settingsand changed to use the ini type instead of using a multiline string.services.nextcloud.config.dbportoption of the Nextcloud module was removed to match upstream. The port can be specified inservices.nextcloud.config.dbhost.services.kavitanow uses the free-form optionservices.kavita.settingsfor the application settings file. The optionsservices.kavita.ipAddressesandservices.kavita.portnow exist atservices.kavita.settings.IpAddressesandservices.kavita.settings.IpAddresses. The file atservices.kavita.tokenKeyFilenow needs to contain a secret with 512+ bits instead of 128+ bits.services.netbirdnow allows running multiple tunnels in parallel throughservices.netbird.tunnels.services.nginx.virtualHostsusingforceSSLorglobalRedirectcan now have redirect codes other than 301 throughredirectCode.services.opensshnow has an optionauthorizedKeysInHomedir, controlling whether~/.ssh/authorizedKeysis added toauthorizedKeysFiles.Note
This option currently defaults to
truefor NixOS 24.05, preserving the previous behaviour. This is expected to change in NixOS 24.11.Warning
Users should check that their SSH keys are in
users.users.*.openssh, or that they have another way to access and administer the system, before setting this option tofalse.services.paperlessmodule no longer uses the previously downloaded NLTK data stored in/var/cache/paperless/nltk. This directory can be removed.services.postgresql.extraPlugins’ type has expanded. Previously it was a list of packages, now it can also be a function that returns such a list. For example a config line likeservices.postgresql.extraPlugins = with pkgs.postgresql_11.pkgs; [ postgis ];is recommended to be changed toservices.postgresql.extraPlugins = ps: with ps; [ postgis ];;services.slskdhas been refactored to include more configuration options in the free-formservices.slskd.settingsoption, and some defaults (including listen ports) have been changed to match the upstream defaults. Additionally, disk logging is now disabled by default, and the log rotation timer has been removed. The nginx virtualhost option is now of thevhost-optionstype.services.sojunow has a wrapper for thesojuctlcommand, pointed at the service config file. It also has the new optionadminSocket.enable, which creates a unix admin socket at/run/soju/admin.services.stalwart-mailuses the legacy version 0.6.X as default because newerstalwart-mailversions require a manual upgrade process. Changeservices.stalwart-mail.packagetopkgs.stalwart-mailif you wish to switch to the new version.services.teeworldsmodule now has a wealth of configuration options, including a newpackageoption.services.xserver.desktopManager.budgieinstallsgnome.gnome-terminalby default (instead ofmate.mate-terminal).services.zfs.zed.enableMailnow uses the globalsendmailwrapper defined by an email module (such as msmtp or Postfix). It no longer requires using a special ZFS build with email support.sonarrversion was bumped to from 3.0.10 to 4.0.3. Consequently existing config database files will be upgraded automatically, but note that some old apparently-working configs might actually be corrupt and fail to upgrade cleanly.stdenv: The--replaceflag insubstitute,substituteInPlace,substituteAll,substituteAllStream, andsubstituteStreamis now deprecated if favor of the new--replace-fail,--replace-warnand--replace-quiet. The deprecated--replaceequates to--replace-warn.systemd: when merging unit options (of typeunitOption), if at least one definition is a list, all those which aren’t are now lifted into a list, making it possible to accumulate definitions without resorting tomkForce, hence to retain the definitions not anticipating that need.systemdunits can now specify theUpholds=andUpheldBy=unit dependencies via the aptly namedupholdsandupheldByoptions. These options get systemd to enforce that the dependencies remain continuously running for as long as the dependent unit is in a running state.A stdenv’s default set of hardening flags can now be set via its
bintools-wrapper’sdefaultHardeningFlagsargument. A convenient stdenv adapter,withDefaultHardeningFlags, can be used to override an existing stdenv’sdefaultHardeningFlags.Programs written in Nim are built with libraries selected by lockfiles. The
nimPackagesandnim2Packagessets have been removed. See https://nixos.org/manual/nixpkgs/unstable#nim for more information.The EC2 image module now enables the Amazon SSM Agent by default.
A new abstraction to create both read-only as well as writable overlay file systems was added. Available via fileSystems.overlay. See also the NixOS docs.
A new hardening flag,
zerocallusedregswas made available, corresponding to the gcc/clang option-fzero-call-used-regs=used-gpr.A new hardening flag,
trivialautovarinitwas made available, corresponding to the gcc/clang option-ftrivial-auto-var-init=pattern.dnsdisthas new options to enable and configure a DNSCrypt endpoint (seeservices.dnsdist.dnscrypt.enable, etc.). The module can generate the DNSCrypt provider key pair and certificates, and also rotates them automatically with no downtime.The kernel Yama LSM is now enabled by default, which prevents ptracing non-child processes. This means you will not be able to attach gdb to an existing process, but will need to start that process from gdb (so it is a child). Or you can set
boot.kernel.sysctl."kernel.yama.ptrace_scope"to 0.Lisp modules: previously deprecated interface based on
common-lisp.shhas now been removed.The
systemd-confinementmodule extension is now compatible withDynamicUser=trueand thusProtectSystem=stricttoo.
Nixpkgs Library
Additions and Improvements
New functions:
lib.asserts.assertEachOneOf: Check that each value is one of the allowed ones.lib.attrsets.longestValidPathPrefix: The longest prefix of an attribute path that refers to an existing attribute in a nesting of attribute sets.lib.attrsets.mapCartesianProduct: Apply a function to the cartesian product of attribute set value combinations.lib.trivial.xor: Boolean “exclusive or”lib.lists.ifilter0: Filter a list for elements that satisfy a predicate function. The predicate function is called with both the index and value for each element.lib.lists.sortOn: Sort a list based on the default comparison of a derived property.lib.path.hasStorePathPrefix: Whether a path has a store path as a prefix.lib.filesystem.packagesFromDirectoryRecursive: Transform a directory tree containing package files suitable forcallPackageinto a matching nested attribute set of derivations.lib.fileset.toList: The list of file paths contained in a given file set.lib.fileset.maybeMissing: Create a file set from a path that may or may not exist.lib.derivations.optionalDrvAttr: Conditionally set a derivation attribute.lib.strings.makeIncludePath: Construct an include search path (such asC_INCLUDE_PATH) containing the header files for a set of packages or paths.
Improvements:
lib.fixedPoints.extends: Better documentationlib.customisation.makeScope: Better documentationlib.derivations.lazyDerivation: Now supports multiple outputs with anoutputsargumentlib.gvariant: Better error message for integers and attribute set valueslib.filesets.gitTracked: Now works within store paths
Misc:
The
lib/directory is a self-contained flake now, including a workinglib.trivial.version(but note that fetching a subtree by itself is not supported in Nix yet)
Module System:
New types:
types.attrTag: A tagged union typetypes.nonEmptyListOf: A non-empty list
Improved types:
types.uniq/uniquenow check the wrapped type
Deprecations
lib.options.mdDocis obsolete and now emits a warning. The core ecosystem has completely migrated to markdown, so marking markdown as markdown is redundant.lib.attrsets.zipWithNamesis now a deprecated alias oflib.attrsets.zipAttrsWithNameslib.attrsets.cartesianProductOfSetshas been renamed tolib.attrsets.cartesianProduct
Internal
libnow has Readme for contributing.Some function’s documentation is now written using the accepted doc comment syntax.
odoohas been updated from16.0.20231024to17.0.20240507.
Release 23.11 (“Tapir”, 2023.11/29)
The NixOS release team is happy to announce a new version of NixOS. The release is called NixOS 23.11 (“Tapir”).
NixOS is a Linux distribution, whose set of packages can also be used on other Linux systems and macOS.
Support is planned until the end of June 2024, handing over to NixOS 24.05.
To upgrade to the latest release, follow the upgrade chapter and check the Breaking Changes section for packages and services used in your configuration.
The team is excited about the many software updates and improvements in this release. Just to name a few, do check the updates
for GNOME packages, systemd, glibc, the ROCM package set, and hostapd (which brings support for WiFi6 (IEEE 802.11ax) and WPA3-SAE-PK).
Make sure to also check the many updates in the Nixpkgs library when developing your own packages.
Table of Contents
NixOS
Breaking Changes
services.postgresql.ensurePermissionshas been deprecated in favor ofservices.postgresql.ensureUsers.*.ensureDBOwnershipwhich simplifies the setup of database owned by a certain system user in local database contexts (which make use of peer authentication via UNIX sockets), migration guidelines were provided in the NixOS manual, please refer to them if you are affected by a PostgreSQL 15 changing the wayGRANT ALL PRIVILEGESis working.services.postgresql.ensurePermissionswill be removed in 24.05. All NixOS modules were migrated using one of the strategy, e.g.ensureDBOwnershiporpostStart. Refer to the PR #266270 for more details.network-online.targethas been fixed to no longer time out for systems withnetworking.useDHCP = trueandnetworking.useNetworkd = true. Workarounds for this can be removed.The
boot.loader.raspberryPioptions have been marked deprecated, with intent of removal for NixOS 24.11. They had a limited use-case, and do not work like people expect. They required either very old installs from (before mid-2019) or customized builds out of scope of the standard and generic AArch64 support. That option set never supported the Raspberry Pi 4 family of devices.python3.pkgs.sequoiawas removed in favor ofpython3.pkgs.pysequoia. The latter package is based on upstream’s dedicated repository for sequoia’s Python bindings, where the Python bindings from gitlab:sequoia-pgp/sequoia were removed long ago.writeTextFilerequiresexecutableto be boolean now, values likenullor""will fail to evaluate now.The latest version of
cloneheronow stores custom content in~/.clonehero. Refer to the migration instructions for more details. Typically, these content files would exist along side the binary, but the previous build used a wrapper script that would store them in~/.config/unity3d/srylain Inc_/Clone Hero.services.mastodondoesn’t support providing a TCP port to itsstreamingcomponent anymore, as upstream implemented parallelization by running multiple instances instead of running multiple processes in one instance. Please create a PR if you are interested in this feature.
Due to this, the desired number of such instancesservices.mastodon.streamingProcessesnow needs to be declared explicitly.The
services.hostapdmodule was rewritten to supportpasswordFilelike options, WPA3-SAE, and management of multiple interfaces. This breaks compatibility with older configurations.hostapdis now started with additional systemd sandbox/hardening options for better security.services.hostapd.interfacewas replaced with a per-radio and per-bss configuration scheme using services.hostapd.radios.services.hostapd.wpahas been replaced by services.hostapd.radios.<name>.networks.<name>.authentication.wpaPassword and services.hostapd.radios.<name>.networks.<name>.authentication.saePasswords which configure WPA2-PSK and WP3-SAE respectively.The default authentication has been changed to WPA3-SAE. Options for other (legacy) schemes are still available.
python3.pkgs.fetchPypiandpython3Packages.fetchPypihave been deprecated in favor of top-levelfetchPypi.xdg-desktop-portal has been updated to 1.18, which reworked how portal implementations are selected. If you roll your own desktop environment, you should either set
xdg.portal.configorxdg.portal.configPackages, which allow fine-grained control over which portal backend to use for specific interfaces, as described in portals.conf(5).If you don’t provide configurations, a portal backend will only be considered when the desktop you use matches its deprecated
UseInkey. While some NixOS desktop modules should already ship one for you, it is suggested to test portal availability by trying Door Knocker and ASHPD Demo. If things regressed, you may runG_MESSAGES_DEBUG=all /path/to/xdg-desktop-portal/libexec/xdg-desktop-portalfor ideas on which config file and which portals are chosen.passnow does not containpassword-store.el. Users should getpassword-store.elfrom Emacs lisp package setemacs.pkgs.password-store.services.knotnow supports.settingsfrom RFC42. The previous.extraConfigstill works the same, but it displays a warning now.services.invoiceplanenow supports.settingsfrom RFC42. The previous.extraConfigstill works the same way, but it displays a warning now.mudoes not installmu4efiles by default now. Users should getmu4efrom Emacs lisp package setemacs.pkgs.mu4e.mariadbnow defaults tomariadb_1011instead ofmariadb_106, meaning the default version was upgraded from v10.6.x to v10.11.x. Refer to the upgrade notes for potential issues.getenthas been moved fromglibc’sbinoutput to its own dedicated output, reducing closure size for many dependents. Dependents using thegetentalias should not be affected; others should move from usingglibc.binorgetBin glibctogetent(which also improves compatibility with non-glibc platforms).maintainers/scripts/update-luarocks-packagesis now a proper packageluarocks-packages-updaterthat can be run to maintain out-of-tree luarocks packages.The
users.users.<name>.passwordFilehas been renamed tousers.users.<name>.hashedPasswordFileto avoid possible confusions. The option is in fact the file-based version ofhashedPassword, notpassword, and expects a file containing the crypt(3) hash of the user password.chromiumBetaandchromiumDevhave been removed due to the lack of maintenance in nixpkgs. Consider usingchromiuminstead.google-chrome-betaandgoogle-chrome-devhave been removed due to the lack of maintenance in nixpkgs. Consider usinggoogle-chromeinstead.The
services.ananicy.extraRulesoption now has the type oflistOf attrsinstead ofstring.buildVimPluginFrom2Nixhas been renamed tobuildVimPlugin, which now now skipsconfigurePhaseandbuildPhase.JACK tools (
jack_*exceptjack_control) have moved from thejack2package tojack-example-tools.The
waagentservice does provisioning now.The
matrix-synapsepackage & module have undergone some significant internal changes, for most setups no intervention is needed, though:The option
services.matrix-synapse.packageis read-only now. For modifying the package, use an overlay which modifiesmatrix-synapse-unwrappedinstead. More on that below.The
enableSystemd&enableRedisarguments have been removed andmatrix-synapsehas been renamed tomatrix-synapse-unwrapped. Also, several optional dependencies (such aspsycopg2orauthlib) have been removed.These optional dependencies are automatically added via a wrapper (
pkgs.matrix-synapse.override { extras = ["redis"]; }forhiredis&txredisapifor instance) if the relevant config section is declared inservices.matrix-synapse.settings. For instance, ifservices.matrix-synapse.settings.redis.enabledis set totrue,"redis"will be automatically added to theextraslist ofpkgs.matrix-synapse.A list of all extras (and the extras enabled by default) can be found at the option’s reference for
services.matrix-synapse.extras.In some cases (e.g. for running synapse workers) it was necessary to re-use the
PYTHONPATHofmatrix-synapse.service’s environment to have all plugins available. This isn’t necessary anymore, insteadconfig.services.matrix-synapse.packagecan be used as it points to the wrapper with properly configuredextrasand also all plugins defined viaservices.matrix-synapse.pluginsavailable. This is also the reason for why the option is read-only now, it’s supposed to be set by the module only.
netboxwas updated to v3.6.services.netbox.packagestill defaults to v3.5 ifstateVersionis earlier than 23.11. Refer to upstream’s breaking changes for v3.6.0 and upgrade NetBox by changingservices.netbox.package. Database migrations will be run automatically.etcdhas been updated to v3.5. Refer to upgrade guides for v3.3 to v3.4 and v3.4 to v3.5 for more details.gitlabinstallations created or updated between versions [15.11.0, 15.11.2] have an incorrect database schema. This will become a problem when upgrading togitlab>=16.2.0. A workaround for affected users can be found in the GitLab docs.consulhas been updated to v1.16.0. Refer to the release note for more details. Once a new Consul version has started and upgraded it’s data directory, it generally cannot be downgraded to the previous version.llvmPackages_rocmhas been moved torocmPackages.llvm.hip,rocm-opencl-runtime,rocm-opencl-icd, androcclrhave been combined intorocmPackages.clr.clang-ocl,clr,composable_kernel,hipblas,hipcc,hip-common,hipcub,hipfft,hipfort,hipify,hipsolver,hipsparse,migraphx,miopen,miopengemm,rccl,rdc,rocalution,rocblas,rocdgbapi,rocfft,rocgdb,rocm-cmake,rocm-comgr,rocm-core,rocm-device-libs,rocminfo,rocmlir,rocm-runtime,rocm-smi,rocm-thunk,rocprim,rocprofiler,rocrand,rocr-debug-agent,rocsolver,rocsparse,rocthrust,roctracer,rocwmma, andtensilehave been moved torocmPackages.himalayahas been updated to v0.8.0, which drops the native TLS support (in favor of Rustls) and add OAuth 2.0 support. Refer to the release note for more details.nix-prefetch-gitnow ignores global and user git config, to improve reproducibility.The services.caddy.acmeCA option defaults to
nullinstead of"https://acme-v02.api.letsencrypt.org/directory"now. To use all of Caddy’s default ACME CAs and enable Caddy’s automatic issuer fallback feature by default, as recommended by upstream.The default priorities of
services.nextcloud.phpOptionshave changed. This means that e.g.services.nextcloud.phpOptions."opcache.interned_strings_buffer" = "23";doesn’t discard all of the other defaults from this option anymore. The attribute values ofphpOptionsare still defaults, these can be overridden as shown here.To override all of the options (including
upload_max_filesize,post_max_sizeandmemory_limitwhich all point toservices.nextcloud.maxUploadSizeby default) can be done like this:{ services.nextcloud.phpOptions = lib.mkForce { # ... }; }php80is no longer supported due to upstream not supporting this version anymore.PHP defaults to PHP 8.2 now, updated from v8.1.
GraalVM has been updated to the latest version, and this brings significant changes. Upstream don’t release multiple versions targeting different JVMs anymore, so now we only have one GraalVM derivation (
graalvm-ce). While at first glance the version may seem a downgrade (v22.3.1 -> v21.0.0), the major version is now following the JVM it targets (so this latest version targets JVM 21). Also some products likellvm-installable-svmandnative-image-svmwere incorporate to the main GraalVM derivation, so they’re included by default.GraalPy (
graalCEPackages.graalpy), TruffleRuby (graalCEPackages.truffleruby), GraalJS (graalCEPackages.graaljs) and GraalNodeJS (grallCEPackages.graalnodejs) are now independent from the main GraalVM derivation.The ISC DHCP package and corresponding module have been removed, because they are EOL upstream. Refer to this post for details and switch to a different DHCP implementation like kea or dnsmasq.
prometheus-unbound-exporterhas been replaced by the Let’s Encrypt maintained version, since the previous version was archived. This requires some changes to the module configuration, most notablecontrolInterfaceneeds migration towardsunbound.hostand requires either thetcp://orunix://URI scheme.odoodefaults to v16 now, updated from v15.varnishwas upgraded from v7.2.x to v7.4.x. Refer to upgrade guides for v7.3 and v7.4. The current LTS version is still offered asvarnish60.util-linuxis now supported on Darwin and is no longer an alias tounixtools. Use theunixtools.util-linuxpackage for access to the Apple variants of the utilities.services.keydchanged API. Now you can create multiple configuration files.baloo, the file indexer and search engine used by KDE now has a patch to prevent files from constantly being reindexed when the device IDs of the their underlying storage change. This happens frequently when using btrfs or LVM. The patch has not yet been accepted upstream but it provides a significantly improved experience. When upgrading, reset baloo to get a clean index:balooctl disable ; balooctl purge ; balooctl enable.The
vlockprogram from thekbdpackage has been moved into its own package output and should now be referenced explicitly askbd.vlockor replaced with an alternative such as the standalonevlockpackage orphyslock.fileSystems.<name>.autoFormatnow usessystemd-makefs, which does not accept formatting options. Therefore,fileSystems.<name>.formatOptionshas been removed.fileSystems.<name>.autoResizeusessystemd-growfsto resize the file system online in Stage 2 now. This means thatf2fsandext2can no longer be auto resized, whilexfsandbtrfsnow can be.fuse3has been updated from v3.11.0 to v3.16.2. Refer to the changelog for an overview of the changes.Unsupported mount options are no longer silently accepted (since 3.15.0). The affected mount options are:
atime,diratime,lazytime,nolazytime,relatime,norelatime,strictatime.For example,
$ sshfs 127.0.0.1:/home/test/testdir /home/test/sshfs_mnt -o atimewould previously terminate successfully with the mount point established, now it outputs the error message
fuse: unknown option(s): `-o atime'and terminates with exit status 1.nixos-rebuild {switch,boot,test,dry-activate}runs the system activation insidesystemd-runnow, creating an ephemeral systemd service and protecting the system switch against issues like network disconnections during remote (e.g. SSH) sessions. This has the side effect of running the switch in an isolated environment, that could possible break post-switch scripts that depends on things like environment variables being set. If you want to opt-out from this behavior for now, you may set theNIXOS_SWITCH_USE_DIRTY_ENVenvironment variable before runningnixos-rebuild. However, keep in mind that this option will be removed in the future.The
services.vaultwarden.configoption default value was changed to make Vaultwarden only listen on localhost, following the secure defaults for most NixOS services.services.lemmy.settings.federationwas removed in v0.17.0 and no longer has any effect. To enable federation, the hostname must be set in the configuration file and then federation must be enabled in the admin web UI. Refer to the release notes for more details.pict-rswas upgraded from v0.3 to v0.4 and contains an incompatible database & configuration change. To upgrade on systems withstateVersion = "23.05";or older follow the migration steps from https://git.asonix.dog/asonix/pict-rs#user-content-0-3-to-0-4-migration-guide and setservices.pict-rs.package = pkgs.pict-rs;.The following packages in
haskellPackageshave a separate bin output now:cabal-fmt,calligraphy,eventlog2html,ghc-debug-brick,hindent,nixfmt,releaser. This means you need to replace e.g."${pkgs.haskellPackages.nixfmt}/bin/nixfmt"with"${lib.getBin pkgs.haskellPackages.nixfmt}/bin/nixfmt"or"${lib.getExe pkgs.haskellPackages.nixfmt}". The binaries also won’t be in scope if you rely on them being installed e.g. viaghcWithPackages.environment.packagespicks thebinoutput automatically, so for normal installation no intervention is required. Also, toplevel attributes likepkgs.nixfmtare not impacted negatively by this change.spamassassinno longer supports theHashcashmodule. The module needs to be removed from theloadpluginlist if it was copied over from the defaultinitPreConfoption.nanowas removed fromenvironment.defaultPackages. To not leave systems without a editor, nowprograms.nano.enableis enabled by default.programs.nano.nanorcandprograms.nano.syntaxHighlightno longer have an effect unlessprograms.nano.enableis set to true which is the default.services.outline.sequelizeArgumentshas been removed, asoutlineno longer executes database migrations via thesequelizecli.The binary of the package
cloud-sql-proxyhas changed fromcloud_sql_proxytocloud-sql-proxy.The module
services.apache-kafkawas largely rewritten and has certain breaking changes. To be precise, this means that the following things have changed:Most settings have been migrated to services.apache-kafka.settings.
Care must be taken when adapting an existing cluster to these changes, see the section called “Migrating to settings”.
By virtue of being less opinionated, it is now possible to use the module to run Apache Kafka in KRaft mode instead of Zookeeper mode.
A few options have been added to assist in this mode.
Garage has been upgraded to v0.9.x.
services.garage.packageneeds to be explicitly set now, so version upgrades can be done in a controlled fashion. For this, we exposegarage_x_yattributes which can be set here.vomsandxrootdnow moves the$out/etccontent to the$etcoutput instead of$out/etc.orig, when input argumentexternalEtcis notnull.The
woodpecker-*CI packages have been updated to v1.0.0. This release is wildly incompatible with the v0.15.x versions that were previously packaged. Refer to upstream’s documentation to learn how to update your CI configurations.Meilisearch was updated from v1.3.1 to v1.5.0. The update has breaking changes about backslashes and filtering. Refer to the release announcement for more details.
The Caddy module gained a new option named
services.caddy.enableReloadwhich is enabled by default. It allows reloading the service instead of restarting it, if only a config file has changed. This option must be disabled if you have turned off the Caddy admin API. If you keep this option enabled, you should consider settinggrace_periodto a non-infinite value to prevent Caddy from delaying the reload indefinitely.mdraid support is optional now. This reduces initramfs size and prevents the potentially undesired automatic detection and activation of software RAID pools. It is disabled by default in new configurations (determined by
stateVersion), but the appropriate settings will be generated bynixos-generate-configwhen installing to a software RAID device, so the standard installation procedure should be unaffected. If you have custom configs relying on mdraid, ensure that you usestateVersioncorrectly or setboot.swraid.enablemanually. On systems with an updatedstateVersionwe now also emit warnings ifmdadm.confdoes not contain the minimum required configuration necessary to run the dynamically enabled monitoring daemons.The
go-ethereumpackage has been updated to v1.12.0. This drops support for proof-of-work. Its GraphQL API now encodes all numeric values as hex strings and the GraphQL UI is updated to v2.0. The default database has changed fromleveldbtopebblebutleveldbcan be forced with the –db.engine=leveldb flag. Thecheckpoint-admincommand was removed along with trusted checkpoints.The
aseprite-unfreepackage has been upgraded from v1.2.16.3 to v1.2.40. The free version of aseprite has been dropped because it is EOL and the package attribute now points to the unfree version. A maintained fork of the last free version of Aseprite, named ‘LibreSprite’, is available in thelibrespritepackage.The default
kopsversion is v1.28.0 now and support for v1.25 and older have been dropped.pharohas been updated to latest stable v10.0.8, which is compatible with the latest stable and oldstable images (Pharo 10 and 11). The VM in question is the 64bit Spur. The 32bit version has been dropped due to lack of maintenance. The Cog VM has been deleted because it is severely outdated. Finally, thepharo-launcherpackage has been deleted because it was not compatible with the newer VM, and due to lack of maintenance.Emacs mainline v29 was introduced. This new version includes many major additions, most notably
tree-sittersupport (enabled by default) and the pgtk variant (useful for Wayland users), which is available under the attributeemacs29-pgtk.Emacs macport version 29 was introduced.
The option
services.networking.networkmanager.enableFccUnlockwas removed in favor ofnetworking.networkmanager.fccUnlockScripts, which allows specifying unlock scripts explicitly. The previous option enabled all unlock scripts bundled with ModemManager, which is risky, and didn’t allow using vendor-provided unlock scripts at all.The
html-prooferpackage has been updated from major version 3 to major version 5, which includes breaking changes.kratoshas been updated from v0.10.1 to the first stable v1.0.0, please read the v0.10.1 to v0.11.0, v0.11.0 to v0.11.1, v0.11.1 to v0.13.0 and v0.13.0 to v1.0.0 upgrade guides. The most notable breaking change is the introduction of one-time passwords (code) and update of the default recovery strategy fromlinktocode.The
hailmodule was removed, ashailwas unmaintained since 2017.Package
noto-fonts-emojiwas renamed tonoto-fonts-color-emoji. Refer to PR #221181 for more details.Package
cloud-sql-proxywas renamed togoogle-cloud-sql-proxyas it cannot be used with other cloud providers.Package
pashwas removed due to being archived upstream. Usepowershellas an alternative.The option
services.plausible.releaseCookiePathhas been removed. Plausible does not use any distributed Erlang features, and does not plan to (refer to discussion), Thus NixOS disables them now , and the Erlang cookie becomes unnecessary. You may delete the file thatreleaseCookiePathwas set to.security.sudo.extraRulesincludesroot’s default rule now, with ordering priority 400. This is functionally identical for users not specifying rule order, or relying onmkBeforeandmkAfter, but may impact users callingmkOrder nwith n ≤ 400.X keyboard extension (XKB) options have been reorganized into a single attribute set,
services.xserver.xkb. Specifically,services.xserver.layoutisservices.xserver.xkb.layoutnow,services.xserver.extraLayoutsisservices.xserver.xkb.extraLayoutsnow,services.xserver.xkbModelisservices.xserver.xkb.modelnow,services.xserver.xkbOptionsisservices.xserver.xkb.optionsnow ,services.xserver.xkbVariantisservices.xserver.xkb.variantnow, andservices.xserver.xkbDirisservices.xserver.xkb.dirnow.networking.networkmanager.firewallBackendwas removed as NixOS is now using iptables-nftables-compat even when using iptables, therefore Networkmanager uses the nftables backend unconditionally now.romewas removed because it is no longer maintained and is succeeded bybiome.The
prometheus-knot-exporterwas migrated to a version maintained by CZ.NIC. Various metric names have changed, so checking existing rules is recommended.The
services.mtr-exporter.targethas been removed in favor ofservices.mtr-exporter.jobswhich allows specifying multiple targets.blender-with-packageshas been deprecated in favor ofblender.withPackages, for exampleblender.withPackages (ps: [ps.bpycv]). It behaves similarly topython3.withPackages.Setting
nixpkgs.configoptions while providing an externalpkgsinstance will now raise an error instead of silently ignoring the options. NixOS modules no longer setnixpkgs.configto accommodate this. This specifically affectsservices.locate,services.xserver.displayManager.lightdm.greeters.tinyandprograms.firefoxNixOS modules. No manual intervention should be required in most cases, however, configurations relying on those modules affecting packages outside the system environment should switch to explicit overlays.privacyidea(and the correspondingprivacyidea-ldap-proxy) has been removed from nixpkgs because it has severely outdated dependencies that became unmaintainable with nixpkgs’ python package-set.daggerwas removed because using a package calleddaggerand packaging it from source violates their trademark policy.win-virtiopackage was renamed tovirtio-winto be consistent with the upstream package name.ps3netsrvhas been replaced with the webman-mod fork, the executable has been renamed fromps3netsrv++tops3netsrvand cli parameters have changed.ssm-agentpackage and module were renamed toamazon-ssm-agentto be consistent with the upstream package name.services.kea.{ctrl-agent,dhcp-ddns,dhcp,dhcp6}now use separate runtime directories instead of/run/keato work around the runtime directory being cleared on service start.mkDerivationrejects MD5 hashes now.The
junicodefont package has been updated to major v2, which is a font family now. In particular, plainJunicode.ttfno longer exists. In addition, TrueType font files are now placed infont/truetypeinstead offont/junicode-ttf; this change does not affect use viafonts.packagesoption.The
prayerpackage as well asservices.prayerhave been removed because it’s been unmaintained for several years and the author’s website has vanished.The
chronyNixOS module now tracks the real-time clock drift from the system clock withrtcfileand automatically adjusts it withrtcautotrimwhen it exceeds the maximum error specified inservices.chrony.autotrimThreshold(defaults to 30 seconds). If you enabledrtcsyncinextraConfig, you should remove RTC related options fromextraConfig. If you do not want chrony configured to keep the RTC in check, you can setservices.chrony.enableRTCTrimming = false;.trilium-desktopandtrilium-serverhave been updated to v0.61. For existing installations, upgrading to this version is supported only after running v0.60.x at least once. If you are still on an older version, make sure to update to v0.60 (available in NixOS 23.05) first and only then to v0.61 (available in NixOS 23.11).Cassandra now defaults to v4.x, updated from v3.11.x.
FoundationDB now defaults to major version 7.
glibc has been updated from v2.37 to v2.38. Refer to the the release notes for more details.
linuxPackages_testing_bcachefsis now soft-deprecated bylinuxPackages_testing.Please consider changing your NixOS configuration’s
boot.kernelPackagestolinuxPackages_testinguntil a stable kernel with bcachefs support is released.
PostgreSQL now defaults to major version 15.
All ROCm packages have been updated to v5.7.0.
ROCm package attribute sets are versioned:
rocmPackages->rocmPackages_5.
systemd has been updated from v253 to v254, refer to the release notes for more details.
boot.resumeDevicemust be specified when hibernating if not in EFI mode.systemd may warn your system about the permissions of your ESP partition (often
/boot), this warning can be ignored for now, we are looking into a satisfying solution regarding this problem.Updating with
nixos-rebuild bootand rebooting is recommended, since in some rare cases thenixos-rebuild switchinto the new generation on a live system might fail due to missing mount units.
If the user has a custom shell enabled via
users.users.${USERNAME}.shell = ${CUSTOMSHELL}, the assertion will require them to also setprograms.${CUSTOMSHELL}.enable = true. This is generally safe behavior, but for anyone needing to opt out from the checkusers.users.${USERNAME}.ignoreShellProgramCheck = truewill do the job.yarn-berryhas been updated to v4.0.1. This means that NodeJS versions less v18.12 are no longer supported by it. Refer to the upstream changelog for more details.GNOME has been updated to v45. Refer to the release notes for more details. Notably, Loupe has replaced Eye of GNOME as the default image viewer, Snapshot has replaced Cheese as the default camera application, and Photos will no longer be installed.
The module
services.ankisyncdhas been switched to anki-sync-server-rs. The former version written in Python was difficult to update, did not receive updates in a while, and did not support recent versions of Anki.Unfortunately all servers supporting new clients do not support the older sync protocol that was used in the old server. This includes newer version of anki-sync-server, Anki’s built in sync server and this new Rust package. Thus old clients will also need updating. In particular nixpkgs’s Anki package is also being updated in this release.
The module update takes care of the new config syntax. The data itself (i.e. user login and card information) is compatible. Thus users of the module will be able to simply log in again after updating both client and server without any extra action needed to be taken.
The argument
vendorSha256ofbuildGoModuleis deprecated. UsevendorHashinstead. Refer to PR #259999) for more details.go-modulesinbuildGoModuleattrs has been renamed togoModules.The package
cawbirdis dropped from nixpkgs. It broke by the Twitter API closing down and has been abandoned upstream.The Cinnamon module now enables XDG desktop integration by default. If you are experiencing collisions related to xdg-desktop-portal-gtk you can safely remove
xdg.portal.extraPortals = [ pkgs.xdg-desktop-portal-gtk ];from your NixOS configuration.GNOME, Pantheon, Cinnamon modules no longer force Qt applications to use Adwaita style. This implementation was buggy and is no longer maintained upstream. Specifically, Cinnamon defaults to the gtk2 style instead now, following the default in Linux Mint). If you still want Adwaita used, you may add the following options to your configuration. Please be aware, that it will probably be removed eventually.
{ qt = { enable = true; platformTheme = "gnome"; style = "adwaita"; }; }DocBook option documentation is no longer supported, all module documentation now uses Markdown.
Docker defaults to v24 now, as 20.10 is stopping to receive security updates and bug fixes after December 10, 2023.
Elixir defaults to v1.15 now. Refer to their changelog for more details.
The
extendfunction ofllvmPackageshas been removed due it coming from thetoolsattrset thus only extending thetoolattrset. A possible replacement is to construct the set fromlibrariesandtools, or patch nixpkgs.ffmpegdefaults toffmpeg_6now, upgrading fromffmpeg_5.fontconfigdefaults to using greyscale antialiasing now. Previously subpixel antialiasing was used because of a recommendation from one of the downstreams. You can change this value by configuringfonts.fontconfig.subpixel.rgbaaccordingly.The
fonts.fontsandfonts.enableDefaultFontsoptions have been renamed tofonts.packagesandfonts.enableDefaultPackagesrespectively.services.hedgedochas been heavily refactored, reducing the amount of declared options in the module. Most of the options should still work without any changes to the configuration. Some options have been deprecated, as they no longer have any effect. Refer to PR #244941 for more details.jqwas updated to v1.7. This is its first release in 5 years.lib.attrsets.foldlAttrsnow always evaluates the initial accumulator argument first.lib.lists.foldl'now always evaluates the initial accumulator argument first. If you depend on the lazier behavior, consider usinglib.lists.foldlorbuiltins.foldl'instead.Now
magmadefaults tomagma-hipinstead ofmagma-cuda. It also respects theconfig.cudaSupportandconfig.rocmSupportoptions.The MariaDB C client library was upgraded from v3.2.x to v3.3.x. Refer to the upstream release notes for more details.
Mattermost has been upgraded to extended support version 8.1 as the previously packaged extended support version 7.8 is reaching end-of-life. Migration may take some time, refer to the changelog and important upgrade notes.
The
netdatapackage disables cloud support by default now. To enable it use thenetdataCloudpackage.networking.nftablesis no longer flushing all rulesets on every reload. Usenetworking.nftables.flushRuleset = true;to enable the previous behaviour.Node.js v14, v16 has been removed as they were end of life. Any dependent packages that contributors were not able to reasonably upgrade were dropped after a month of notice to their maintainers, were removed.
This includes VSCode Server.
This includes Kibana 7 as the ELK stack is unmaintained in nixpkgs and is marked for slow removal.
The application firewall
opensnitchuses the process monitor method eBPF as default now. This is recommended by upstream. The method may be changed with the setting services.opensnitch.settings.ProcMonitorMethod.paperworkis updated to v2.2. Documents scanned with this version will not be visible to previous versions if you downgrade. Refer to the upstream announcement for details and workarounds.The latest available version of Nextcloud is v27 (available as
pkgs.nextcloud27). The installation logic is as follows:If
services.nextcloud.packageis specified explicitly, this package will be installed (recommended)If
system.stateVersionis >=23.11,pkgs.nextcloud27will be installed by default.If
system.stateVersionis >=23.05,pkgs.nextcloud26will be installed by default.Please note that an upgrade from v25 (or older) to v27 is not possible directly. Please upgrade to
nextcloud26(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You may upgrade by declaringservices.nextcloud.package = pkgs.nextcloud26;in between.
postgresql_11has been removed since it’ll stop receiving fixes on November 9th 2023.programs.gnupg.agent.pinentryFlavoris set in/etc/gnupg/gpg-agent.confnow. It will no longer take precedence over apinentry-programset in~/.gnupg/gpg-agent.conf.python3.pkgs.flitBuildHookhas been removed. Useflit-coreandformat = "pyproject"instead.Certificate generation via the
security.acmelimits the concurrent number of running certificate renewals and generation jobs now. This is to avoid spiking resource usage when processing many certificates at once. The limit defaults to 5 and can be adjusted viamaxConcurrentRenewals. Setting the value to 0 disables the limits altogether.services.borgmatic.settings.locationandservices.borgmatic.configurations.<name>.locationare deprecated, please move your options out of sections to the global scope.services.fail2ban.jailscan be configured with attribute sets now, defining settings and filters instead of lines. The stringed optionsdaemonConfigandextraSettingshave respectively been replaced bydaemonSettingsandjails.DEFAULT.settings. Those use attribute sets.The
services.mbpfanmodule has the optionaggressiveenabled by default now. This is for better heat moderation. To get the upstream defaults you may disable this.Apptainer/Singularity defaults to using
"$out/var/lib"for theLOCALSTATEDIRconfiguration option instead of the top-level"/var/lib"now. This change impacts theSESSIONDIR(container-run-time mount point) configuration, which is set to$LOCALSTATEDIR/<apptainer or singularity>/mnt/session. This detaches the packages from the top-level directory, rendering the NixOS module optional.The default behavior of the NixOS module
programs.singularitystays unchanged. We add a new optionprograms.singularity.enableExternalSysConfDir(default totrue) to specify whether to set the top-level"/var/lib"asLOCALSTATEDIRor not.The
services.sslhmodule has been updated to follow RFC 0042. As such, several options have been moved to the freeform attribute set services.sslh.settings, which allows to change any of the settings in sslh(8).In addition, the newly added option services.sslh.method allows to switch between the fork(2), select(2) and
libev-based connection handling method. Refer to the sslh docs for a comparison.Suricata was upgraded from v6.0 to v7.0 and no longer considers HTTP/2 support as experimental. Refer to upstream release notes for more details.
teleporthas been upgraded from major version 12 to major version 14. Refer to upstream upgrade instructions and release notes for v13 and v14. Note that Teleport does not officially support upgrades across more than one major version at a time. If you’re running Teleport server components, it is recommended to first upgrade to an intermediate v13.x version by settingservices.teleport.package = pkgs.teleport_13. Afterwards, this option can be removed to upgrade to the default version (14).zfswas updated from v2.1.x to v2.2.0, enabling newer kernel support and adding new features.The use of
sourceRoot = "source";,sourceRoot = "source/subdir";, and similar lines in package derivations using the defaultunpackPhaseis deprecated as it requiresunpackPhaseto always produce a directory named “source”. UsesourceRoot = src.name,sourceRoot = "${src.name}/subdir";, orsetSourceRoot = "sourceRoot=$(echo */subdir)";or similar instead.The
djangoalias in the python package set was upgraded to Django v4.x. Applications that consume Django should always pin their python environment to a compatible major version, so they can move at their own pace.{ python = python3.override { packageOverrides = self: super: { django = super.django_3; }; }; }The
qemu-vm.nixmodule by default now identifies block devices via persistent names available in/dev/disk/by-*. Because the rootDevice is identified by its filesystem label, it needs to be formatted before the VM is started. The functionality of automatically formatting the rootDevice in the initrd is removed from the QEMU module. However, for tests that depend on this functionality, a test utility for the scripted initrd is added (nixos/tests/common/auto-format-root-device.nix). To use this in a NixOS test, import the module, e.g.imports = [ ./common/auto-format-root-device.nix ];When you use the systemd initrd, you can automatically format the root device by settingvirtualisation.fileSystems."/".autoFormat = true;.The
electronpackages places its application files in$out/libexec/electroninstead of$out/lib/electronnow. Packages using electron-builder will fail to build and need to be adjusted by changinglibtolibexec.
New Services
MCHPRS, a multithreaded Minecraft server built for redstone. Available as services.mchprs.
acme-dns, a limited DNS server to handle ACME DNS challenges easily and securely. Available as services.acme-dns.
frp, a fast reverse proxy to help you expose a local server behind a NAT or firewall to the Internet. Available as
services.frp.river, A dynamic tiling wayland compositor. Available as
programs.river.wayfire, a modular and extensible wayland compositor. Available as programs.wayfire.
mautrix-whatsapp, a Matrix-WhatsApp puppeting bridge. Available as services.mautrix-whatsapp.
hddfancontrol, a service to regulate fan speeds based on hard drive temperature. Available as services.hddfancontrol.
seatd, A minimal seat management daemon. Available as services.seatd.
GoToSocial, an ActivityPub social network server written in Golang. Available as services.gotosocial.
Castopod, an open-source hosting platform made for podcasters who want to engage and interact with their audience. Available as services.castopod.
Typesense, a fast, typo-tolerant search engine for building delightful search experiences. Available as services.typesense.
NS-USBLoader, an all-in-one tool for managing Nintendo Switch homebrew. Available as programs.ns-usbloader.
athens, a Go module datastore and proxy. Available as services.athens.
Mobilizon, a Fediverse platform for publishing events. Available as services.mobilizon.
Anuko Time Tracker, a simple, easy to use, open source time tracking system. Available as services.anuko-time-tracker.
Prometheus MySQL exporter, a MySQL server exporter for Prometheus. Available as services.prometheus.exporters.mysqld.
LibreNMS, a auto-discovering PHP/MySQL/SNMP based network monitoring. Available as services.librenms.
Livebook, an interactive notebook with support for Elixir, graphs, machine learning, and more. Available as services.livebook.
sitespeed-io, a tool that can generate metrics such as timings and diagnostics for websites. Available as services.sitespeed-io.
stalwart-mail, an all-in-one email server (SMTP, IMAP, JMAP). Available as
services.stalwart-mail.tang, a server for binding data to network presence. Available as services.tang.
Jool, a kernelspace NAT64 and SIIT implementation providing translation between IPv4 and IPv6. Available as networking.jool.enable.
Home Assistant Satellite, a streaming audio satellite for Home Assistant voice pipelines, where you can reuse existing mic and speaker hardware. Available as
services.homeassistant-satellite.Apache Guacamole, a cross-platform, clientless remote desktop gateway. Available as services.guacamole-server and services.guacamole-client services.
pgBouncer, a PostgreSQL connection pooler. Available as services.pgbouncer.
Goss, a YAML based serverspec alternative tool for validating a server’s configuration. Available as services.goss.
trust-dns, a Rust based DNS server built to be safe and secure from the ground up. Available as
services.trust-dns.osquery, a SQL powered operating system instrumentation, monitoring, and analytics. Available as services.osquery.
ebusd, a daemon for handling communication with eBUS devices connected to a 2-wire bus system (“energy bus” used by numerous heating systems). Available as services.ebusd.
systemd-sysupdate, atomically updates the host OS, container images, portable service images or other sources. Available as systemd.sysupdate.
eris-server, an implementation of the Encoding for Robust Immutable Storage (ERIS). Available as
services.eris-server.forgejo, a git forge and drop-in replacement for Gitea. Available as services.forgejo.
hardware/infiniband.nixadds infiniband subnet manager support using an opensm systemd-template service, instantiated on card guids. The module also adds kernel modules and cli tooling to help administrators debug and measure performance. Available as hardware.infiniband.enable.zwave-js, a small server wrapper around Z-Wave JS to access it via a WebSocket. Available as services.zwave-js.
Honk, a complete ActivityPub server with minimal setup and support costs. Available as services.honk.
ferretdb, an open-source proxy, converting the MongoDB 6.0+ wire protocol queries to PostgreSQL or SQLite. Available as services.ferretdb.
MicroBin, a feature rich, performant and secure text and file sharing web application, a “paste bin”. Available as services.microbin.
NNCP, nncp-daemon and nncp-caller services. Available as programs.nncp.settings and services.nncp.
FastNetMon Advanced, a commercial high performance DDoS detector and sensor. Available as services.fastnetmon-advanced.
tuxedo-rs, Rust utilities for interacting with hardware from TUXEDO Computers. Available as hardware.tuxedo-rs.
certspotter, a certificate transparency log monitor. Available as services.certspotter.
audiobookshelf, a self-hosted audiobook and podcast server. Available as services.audiobookshelf.
ZITADEL, a turnkey identity and access management platform. Available as services.zitadel.
exportarr, Prometheus Exporters for Bazarr, Lidarr, Prowlarr, Radarr, Readarr, and Sonarr. Available as services.prometheus.exporters.exportarr-bazarr/services.prometheus.exporters.exportarr-lidarr/services.prometheus.exporters.exportarr-prowlarr/services.prometheus.exporters.exportarr-radarr/services.prometheus.exporters.exportarr-readarr/services.prometheus.exporters.exportarr-sonarr.
netclient, an automated WireGuard Management Client. Available as services.netclient.
trunk-ng, A fork of
trunk: Build, bundle & ship your Rust WASM application to the webvirt-manager, an UI for managing virtual machines in libvirt. Available as programs.virt-manager.
Soft Serve, a tasty, self-hostable Git server for the command line. Available as services.soft-serve.
Rosenpass, a service for post-quantum-secure VPNs with WireGuard. Available as services.rosenpass.
c2FmZQ, an application that can securely encrypt, store, and share files, including but not limited to pictures and videos. Available as services.c2fmzq-server.
preload, a service that makes applications run faster by prefetching binaries and shared objects. Available as
services.preload.
Other Notable Changes
The new option
system.switch.enablewas added. It is enabled by default. Disabling it makes the system unable to be reconfigured vianixos-rebuild. This is of advantage for image based appliances where updates are handled outside the image.services.searxreceives new options for better SearXNG support. This includes options for the built-in rate limiter, bot protection and automatically configuring a local Redis server.The iptables firewall module installs the
nixos-firewall-toolnow which allows the user to easily temporarily open ports through the firewall.A new option was added to the virtualisation module that enables specifying explicitly named network interfaces in QEMU VMs. The existing
virtualisation.vlansis still supported for cases where the name of the network interface is irrelevant.services.outlinecan be configured to use local filesystem storage now. Previously only S3 storage was possible. This may be set using services.outline.storage.storageType.pkgs.openvpn3optionally supports systemd-resolved now.programs.openvpn3will automatically enable systemd-resolved support if services.resolved.enable is set to true.The services.woodpecker-server.environmentFile type was changed to list of paths to be more consistent to the woodpecker-agent module
services.matrix-synapsehas new options to configure worker processes for matrix-synapse usingservices.matrix-synapse.workers. Configuring a local redis server usingservices.matrix-synapse.configureRedisLocallyis also possible now.The
services.nginxmodule gained adefaultListenoption at server-level with support for PROXY protocol listeners. AlsoproxyProtocolis exposed in theservices.nginx.virtualHosts.<name>.listenoption now. This it is possible to run PROXY listeners and non-PROXY listeners at a server-level. Refer to PR #213510 for more details.services.restic.backupsadds wrapper scripts to your system path now. This wrapper script sets the same environment variables as the service, so restic operations can easily be run from the command line. This behavior can be disabled by settingcreateWrappertofalse, for each backup configuration.services.prometheus.exportershas a new exporter to monitor electrical power consumption based on PowercapRAPL sensor called Scaphandre. Refer to PR #239803 for more details.The
services.calibre-servermodule has new options to configure thehost,port,auth.enable,auth.modeandauth.userDbpath. Refer to PR #216497 for more details.services.prometheus.exportershas a new exporter to monitor PHP-FPM processes. Refer to PR #240394 for more details.services.github-runnerandservices.github-runners.<name>gained the optionnodeRuntimes. This option defaults to[ "node20" ]. I.e., the service supports Node.js 20 GitHub Actions only. The list of Node.js versions accepted bynodeRuntimestracks the versions the upstream GitHub Actions runner supports. Refer to PR #249103 for details.programs.gnupghas the optionagent.settingsnow. This allows setting verbatim config values in/etc/gnupg/gpg-agent.conf.dockerTools.buildImage,dockerTools.buildLayeredImageanddockerTools.streamLayeredImageuselib.makeOverridablenow . This allowsdockerTools-based images to be customized more efficiently at the Nix level.services.influxdb2supports doing an automatic initial setup and provisioning of users, organizations, buckets and authentication tokens now. Refer to PR #249502 for more details.wrapHelmexposespassthru.pluginsDirnow which can be passed tohelmfile. For convenience, a top-level packagehelmfile-wrappedhas been added, which inheritspassthru.pluginsDirfromkubernetes-helm-wrapped. Refer to PR #217768 for more details.The
boot.initrd.network.udhcp.enableoption allows control over DHCP during Stage 1 regardless of whatnetworking.useDHCPis set to.networking.nftableshas the optionnetworking.nftables.table.<table>now. This creates tables and have them be updated atomically, instead of flushing the ruleset.hardware.nvidiagaineddatacenteroptions for enabling NVIDIA Data Center drivers and configuration of NVLink/NVSwitch topologies throughnv-fabricmanager.The new
boot.bcache.enableoption allows completely removingbcachemount support. It is enabled by default.security.sudoprovides two extra options now, while not changing the module’s default behaviour:defaultOptionscontrols the options used for the default rules;keepTerminfocontrols whetherTERMINFOandTERMINFO_DIRSare preserved forrootand thewheelgroup.
virtualisation.googleComputeImageprovides aefioption to support UEFI booting now.CoreDNS may be built with external plugins now. This may be done by overriding
externalPluginsandvendorHasharguments like this:{ services.coredns = { enable = true; package = pkgs.coredns.override { externalPlugins = [ { name = "fanout"; repo = "github.com/networkservicemesh/fanout"; version = "v1.9.1"; } ]; vendorHash = "<SRI hash>"; }; }; }To get the necessary SRI hash, set
vendorHash = "";. The build will fail and produce the correctvendorHashin the error message.If you use this feature, updates to CoreDNS may require updating
vendorHashby following these steps again.Using
fusumaenables the following plugins now: appmatcher, keypress, sendkey, tap and wmctrl.The Home Assistant module offers support for installing custom components and lovelace modules now. Available at
services.home-assistant.customComponentsandservices.home-assistant.customLovelaceModules.TeX Live environments can now be built with the new
texlive.withPackages. The procedure for creating custom TeX packages has been changed. Refer to the Nixpkgs manual for more details.In
wxGTK32, the webkit modulewxWebViewhas been enabled on all builds. Prior releases only enabled this on Darwin.Support for WiFi6 (IEEE 802.11ax) and WPA3-SAE-PK was enabled in the
hostapdpackage, along with a significant rework of the hostapd module.LXD supports virtual machine instances now to complement the existing container support.
The
nixos-rebuildcommand has been given alist-generationssubcommand. Refer toman nixos-rebuildfor more details.sudo-rs, a reimplementation ofsudoin Rust, is now supported. An experimental new modulesecurity.sudo-rswas added. Switching to it (viasecurity.sudo-rs.enable = true;) introduces slight changes in sudo behaviour, due tosudo-rs’ current limitations:terminfo-related environment variables aren’t preserved for
rootandwheel;rootandwheelare not given the ability to set (or preserve) arbitrary environment variables.
Note: The
sudo-rsmodule only takes configuration throughsecurity.sudo-rs, and in particular does not automatically use previously-set rules; this could be achieved withsecurity.sudo-rs.extraRules = security.sudo.extraRules;for instance.
There is a new NixOS option when writing NixOS tests
testing.initrdBackdoor, that enablesbackdoor.servicein initrd. Requiresboot.initrd.systemd.enableto be enabled. Boot will pause in Stage 1 atinitrd.target, and will listen for commands from theMachinepython interface, just like Stage 2 normally does. This enables commands to be sent to test and debug Stage 1. Usemachine.switch_root()to leave Stage 1 and proceed to Stage 2.The Linux kernel module
msr(refer tomsr(4)), which provides an interface to read and write the model-specific registers (MSRs) of an x86 CPU, can now be configured viahardware.cpu.x86.msr.The
qemu-vm.nixmodule now supports disabling overridingfileSystemswithvirtualisation.fileSystems. This enables the user to boot VMs from “external” disk images not created by the qemu-vm module. You can stop the qemu-vm module from overridingfileSystemsby settingvirtualisation.fileSystems = lib.mkForce { };.When using split parity files in
snapraid, the snapraid-sync systemd service will no longer fail to run.wpa_supplicant’s configuration file cannot be read by non-root users, and secrets (such as Pre-Shared Keys) can safely be passed vianetworking.wireless.environmentFile.The configuration file could previously be read, when
userControlled.enable(non-default), by users who are in bothwheelanduserControlled.group(defaults towheel)
Nixpkgs Library
Breaking Changes
lib.lists.foldl'now always evaluates the initial accumulator argument first. If you depend on the lazier behavior, consider usinglib.lists.foldlorbuiltins.foldl'instead.lib.attrsets.foldlAttrsnow always evaluates the initial accumulator argument first.Now that the internal NixOS transition to Markdown documentation is complete,
lib.options.literalDocBookhas been removed after deprecation in 22.11.lib.types.stringis now fully deprecated and gives a warning when used.
Additions and Improvements
lib.fileset: A new sub-library to select local files to use for sources, designed to be easy and safe to use.This aims to be a replacement for
lib.sources-based filtering. To learn more about it, see the blog post or the tutorial.lib.gvariant: A partial and basic implementation of GVariant formatted strings. See GVariant Format Strings for details.Warning
This API is not considered fully stable and it might therefore change in backwards incompatible ways without prior notice.
lib.asserts: New function:assertEachOneOf.lib.attrsets: New function:attrsToList.lib.customisation: New function:makeScopeWithSplicing'.lib.fixedPoints: Documentation improvements forlib.fixedPoints.fix.lib.generators: New functions:mkDconfKeyValue,toDconfINI.lib.generators.toKeyValuenow supports theindentattribute in its first argument.lib.lists: New functions:findFirstIndex,hasPrefix,removePrefix,commonPrefix,allUnique.Documentation improvements for
lib.lists.foldl'.lib.meta: Documentation of functions now gets renderedlib.path: New functions:hasPrefix,removePrefix,splitRoot,subpath.components.lib.strings: New functions:replicate,cmakeOptionType,cmakeBool,cmakeFeature.lib.trivial: New function:mirrorFunctionArgs.lib.systems: New function:equals.lib.options: Improved documentation formkPackageOption.mkPackageOption. now also supports thepkgsTextattribute.
Module system:
Options in the
optionsmodule argument now have thedeclarationPositionsattribute containing the position where the option was declared:$ nix-repl -f '<nixpkgs/nixos>' [...] nix-repl> :p options.environment.systemPackages.declarationPositions [ { column = 7; file = "/nix/store/vm9zf9wvfd628cchj0hdij1g4hzjrcz9-source/nixos/modules/config/system-path.nix"; line = 62; } ]Not to be confused with
definitionsWithLocations, which is the same but for option definitions.Improved error message for option declarations missing
mkOption
Deprecations
lib.meta.getExe pkg(also available aslib.getExe) now gives a warning ifpkg.meta.mainProgramis not set, but it continues to default to the derivation name. Nixpkgs accepts PRs that setmeta.mainProgramon packages where it makes sense. Uselib.getExe' pkg "some-command"to avoid the warning and/or select a different executable.
Release 23.05 (“Stoat”, 2023.05/31)
The NixOS release team is happy to announce a new version of NixOS. The release is called NixOS 23.05 (“Stoat”).
NixOS is a Linux distribution, whose set of packages can also be used on other Linux systems and macOS.
Support is planned until the end of December 2023, handing over to NixOS 23.11.
To upgrade to the latest release, follow the upgrade chapter.
Highlights
In addition to numerous new and updated packages, this release has the following highlights:
The default Nix version was updated from 2.11 to 2.13. In particular, this includes a small language alteration in the way floats are represented in
builtins.toJSON. See the release notes for 2.12 and 2.13 for more information.The default Linux Kernel was updated from version 5.15 to 6.1, see Kernelnewbies for what has changed. All Kernels currently shown on kernel.org are available.
systemd has been updated from v252 to v253, see the release notes for more information on the changes.
Updating with
nixos-rebuild bootand rebooting is recommended, since in some rare cases thenixos-rebuild switchinto the new generation on a live system might fail due to missing mount units.
glibc has been updated from version 2.35 to 2.37, see the release notes for what was changed.
libxcrypt, the library providing the
crypt(3)password hashing function, is now built without support for algorithms not flaggedstrong. This affects the availability of password hashing algorithms used for system login (login(1),passwd(1)), but also Apache2 Basic-Auth, Samba, OpenLDAP, Dovecot, and many other packages.NixOS now defaults to using nsncd, a non-caching reimplementation of nscd in Rust, as its NSS lookup dispatcher. This replaces the buggy and deprecated nscd implementation provided through glibc. When you find problems, you can switch back by disabling it:
{ services.nscd.enableNsncd = false; }The internal option
boot.bootspec.enableis now enabled by default because RFC 0125 was merged. This means you will have a bootspec document calledboot.jsongenerated for each system and specialisation in the top-level. This is useful to enable advanced boot use cases in NixOS, such as Secure Boot.Two changes to
nixos-rebuildare important to highlight as well.Support for an extra
--specialisationoption was added that can be used to change specialisation forswitchandtestcommands.The
--target-hostand--build-hostoptions no longer treat thelocalhostvalue specially – to build on resp. deploy to a local machine, omit the relevant flag.
Python implements PEP 668, providing better feedback to users that try to run
pip installfor system-wide or user home installations.Cinnamon has been updated to version 5.6, see the pull request for what was changed.
GNOME has been updated to version 44, see the the release notes for details.
KDE Plasma has been updated to version 5.27, see the release notes for what was changed.
openrawas updated to20230225. Due to large scope of the update, currently onlyopenraPackages.engines.releaseandopenraPackages.engines.latestpackages are available. If you want to use the old engine versions or mods, they were moved to theopenraPackages_2019namespace.
New Services
Akkoma, an ActivityPub microblogging server. Available as services.akkoma.
alertmanager-irc-relay, a Prometheus Alertmanager IRC Relay. Available as services.prometheus.alertmanagerIrcRelay.
alice-lg, a looking-glass for BGP sessions. Available as services.alice-lg.
atuin, a sync server for shell history. Available as services.atuin.
authelia, an open-source authentication and authorization server. Available as services.authelia.
birdwatcher, a small HTTP server meant to provide an API defined by Barry O’Donovan’s birds-eye to the BIRD internet routing daemon. Available as services.birdwatcher.
blesh, a line editor written in pure bash. Available as programs.bash.blesh.
Budgie Desktop, a familiar, modern desktop environment. Available as
services.xserver.desktopManager.budgie.clash-verge, a Clash GUI based on tauri. Available as programs.clash-verge.
Cloudlog, a web-based Amateur Radio logging application. Available as services.cloudlog.
consul-template, a template renderer, notifier, and supervisor for HashiCorp Consul and Vault data. Available as services.consul-template.
cups-pdf-to-pdf, a PDF-generating CUPS backend based on cups-pdf. Available as services.printing.cups-pdf.
Deepin Desktop Environment, an elegant, easy to use and reliable desktop environment. Available as services.xserver.desktopManager.deepin.
esphome, a dashboard to configure ESP8266/ESP32 devices for use with Home Automation systems. Available as services.esphome.
frigate, an open source NVR built around real-time AI object detection. Available as services.frigate.
fzf, a command line fuzzyfinder. Available as programs.fzf.
gemstash, a RubyGems.org cache and private gem server. Available as services.gemstash.
gitea-actions-runner, a CI runner for Gitea/Forgejo Actions. Available as services.gitea-actions-runner.
evdevremapkeys, a daemon to remap key events. Available as services.evdevremapkeys.
gmediarender, a simple, headless UPnP/DLNA renderer. Available as services.gmediarender.
go2rtc, a camera streaming application with support for RTSP, WebRTC, HomeKit, FFMPEG, RTMP and other protocols. Available as services.go2rtc.
goeland, an alternative to rss2email written in Golang with many filters. Available as services.goeland.
gonic, a Subsonic music streaming server. Available as services.gonic.
hardware.ipu6, drivers for IPU6 based webcams on Intel Tiger Lake and Alder Lake.
harmonia, a Nix binary cache implemented in Rust using libnixstore. Available as services.harmonia.
hyprland, a dynamic tiling Wayland compositor that doesn’t sacrifice on its looks. Available as programs.hyprland.
imaginary, a microservice for high-level image processing that Nextcloud can use to generate previews. Available as services.imaginary.
ivpn, a secure, private VPN with fast WireGuard connections. Available as services.ivpn.
vmalert, an alerting engine for VictoriaMetrics. Available as services.vmalert.instances.
jellyseerr, a web-based requests manager for Jellyfin, forked from Overseerr. Available as
services.jellyseerr.kavita, a self-hosted digital library. Available as services.kavita.
keyd, a key remapping daemon for Linux. Available as services.keyd.
lldap, a lightweight authentication server that provides an opinionated, simplified LDAP interface for authentication. Available as services.lldap.
minipro, an open source program for controlling the MiniPRO TL866xx series of chip programmers. Available as programs.minipro.
mmsd, a lower level daemon that transmits and receives MMSes. Available as services.mmsd.
monica, an open source personal CRM. Available as services.monica.
networkd-dispatcher, a dispatcher service for systemd-networkd connection status changes. Available as services.networkd-dispatcher.
nimdow, a window manager written in Nim, inspired by dwm. Available as services.xserver.windowManager.nimdow.enable.
opensearch, a search server alternative to Elasticsearch. Available as services.opensearch.
openvscode-server, run VS Code on a remote machine with access through a modern web browser from any device, anywhere. Available as services.openvscode-server.
peroxide, a fork of the official ProtonMail bridge that aims to be similar to Hydroxide. Available as services.peroxide.
photoprism, a AI-powered photos app for the decentralized web. Available as services.photoprism.
Pixelfed, an Instagram-like ActivityPub server. Available as services.pixelfed.
PufferPanel, a game server management panel designed to be easy to use. Available as services.pufferpanel.
QDMR, a GUI application and command line tool for programming DMR radios programs.qdmr.
readarr, book manager and automation (Sonarr for ebooks). Available as services.readarr.
ReGreet, a clean and customizable greeter for greetd. Available as programs.regreet.
rshim, the user-space rshim driver for the BlueField SoC. Available as services.rshim.
SFTPGo, a fully featured and highly configurable SFTP server with optional HTTP/S, FTP/S and WebDAV support. Available as services.sftpgo.
sharing, a command-line tool to share directories and files from the CLI to iOS and Android devices without the need of an extra client app. Available as programs.sharing.
sniffnet, an application to monitor your network traffic. Available as programs.sniffnet.
stargazer, a fast and easy to use Gemini server. Available as services.stargazer.
stevenblack-blocklist, a unified hosts file with base extensions for blocking unwanted websites. Available as networking.stevenblack.
systemd-repart, grow and add partitions to a partition table. Available as systemd.repart and boot.initrd.systemd.repart
trippy, a network diagnostic tool. Available as programs.trippy.
tts, a battle-tested deep learning toolkit for Text-to-Speech. Multiple servers may be configured below services.tts.servers.
ulogd, a userspace logging daemon for netfilter/iptables related logging. Available as services.ulogd.
v2rayA, a Linux web GUI client of Project V which supports V2Ray, Xray, SS, SSR, Trojan and Pingtunnel. Available as services.v2raya.
v4l2-relayd, a streaming relay for v4l2loopback using gstreamer. Available as services.v4l2-relayd.
vault-agent, a template renderer and API auth proxy for HashiCorp Vault, similar to
consul-template. Available as services.vault-agent.webhook, a lightweight webhook server. Available as services.webhook.
wgautomesh, a simple utility to help connect wireguard nodes together in a full mesh topology. Available as services.wgautomesh.
woodpecker, a simple CI engine with great extensibility. Available as services.woodpecker-server and services.woodpecker-agents.
wstunnel, a proxy tunnelling arbitrary TCP or UDP traffic through a WebSocket connection. Available as services.wstunnel.
Backward Incompatibilities
services.asusdconfiguration now uses strings instead of structured configuration, as upstream switched to the RON configuration format. Support for structured configuration may return when RON generation is implemented in nixpkgs.borgbackupmodule now has an option for inhibiting system sleep while backups are running, defaulting to off (not inhibiting sleep), available asservices.borgbackup.jobs.<name>.inhibitsSleep.The
opensshclient now comes with the~Cescape sequence disabled by default. It can be re-enabled by settingEnableEscapeCommandline yesThe
programs.sshclient module does not read/etc/ssh/ssh_known_hosts2anymore, since this location is deprecated since 2001.The
services.opensshserver module does not read~/.ssh/authorized_keys2anymore, since this location is deprecated since 2001.MAC-then-encrypt algorithms were removed from the default selection of
services.openssh.settings.Macs. If you still require these MACs, for example when you are relying on libssh2 (e.g. VLC) or the SSH library shipped on the iPhone, you can re-add them like this:{ services.openssh.settings.Macs = [ "hmac-sha2-512" "hmac-sha2-256" "umac-128@openssh.com" ]; }podmannow uses thenetavarknetwork stack. Users will need to delete all of their local containers, images, volumes, etc, by runningpodman system reset --forceonce before upgrading their systems.git-bughas been updated to at least version 0.8.0, which includes backwards incompatible changes. Thegit-bug-migrationpackage can be used to upgrade existing repositories.grayloghas been updated to version 5, which can not be updated directly from the previously packaged version 3.3. If you had installed the previously packaged version 3.3, please follow the upgrade path from 3.3 to 4.0 to 4.3 to 5.0.buildFHSUserEnvis now calledbuildFHSEnvand uses FlatPak’s Bubblewrap sandboxing tool rather than Nixpkgs’ own chrootenv. The old chrootenv-based implementation is still available viabuildFHSEnvChrootbut is considered deprecated and will be removed when the remaining uses inside Nixpkgs have been migrated. If your FHSEnv-wrapped application misbehaves when using the new bubblewrap implementation, please create an issue in Nixpkgs.nushellhas been updated to at least version 0.77.0, which includes potential breaking changes in aliases. The old aliases are now available asold-aliasbut it is recommended you migrate to the new format. See Reworked aliases.gajimhas been updated to version 1.7.3 which has disabled legacy ciphers. See changelog for version 1.7.0.keepassxandkeepassx2have been removed, due to upstream stopping development. Consider KeePassXC as a maintained alternative.The services.kubo.settings option is now no longer stateful. If you changed any of the options in services.kubo.settings in the past and then removed them from your NixOS configuration again, those changes are still in your Kubo configuration file but will now be reset to the default. If you’re unsure, you may want to make a backup of your configuration file (probably
/var/lib/ipfs/config) and compare after the update.The Kubo HTTP API will no longer listen on localhost and will instead only listen on a Unix domain socket by default. Read the services.kubo.settings.Addresses.API option description for more information.
The EC2 image module no longer fetches instance metadata in stage-1. This results in a significantly smaller initramfs, since network drivers no longer need to be included, and faster boots, since metadata fetching can happen in parallel with startup of other services. This breaks services which rely on metadata being present by the time stage-2 is entered. Anything which reads EC2 metadata from
/etc/ec2-metadatashould now have anafterdependency onfetch-ec2-metadata.serviceThe mailman service now defaults to using a randomly generated REST API password instead of a hard-coded one.
minioremoved support for its legacy filesystem backend in RELEASE.2022-10-29T06-21-33Z. This means if your storage was created with the old format, minio will no longer start. Unfortunately, minio doesn’t provide an automatic migration, they only provide instructions how to manually convert the node. To facilitate this migration, we keep around the last version that still supports the old filesystem backend asminio_legacy_fs. Use it viaservices.minio.package = minio_legacy_fs;to export your data before switching to the new version. See the corresponding issue for more details.services.sourcehut.dispatchand the corresponding package (sourcehut.dispatchsrht) have been removed due to upstream deprecation.The attributes used by
services.snapper.configs.<name>have changed. Migrate from this:{ services.snapper.configs.example = { subvolume = "/example"; extraConfig = '' ALLOW_USERS="alice" ''; }; }to this:
{ services.snapper.configs.example = { SUBVOLUME = "/example"; ALLOW_USERS = [ "alice" ]; }; }The default module options for services.snapserver.openFirewall, services.tmate-ssh-server.openFirewall and
services.unifi-video.openFirewallhave been changed fromtruetofalse. You will need to explicitly set this option totrue, or configure your firewall.The option
i18n.inputMethod.fcitx5.enableRimeDatahas been removed. Default RIME data is now included infcitx5-rimeby default, and can be customized usingfcitx5-rime.override { rimeDataPkgs = [ pkgs.rime-data # ... ]; }The
udevhwdb.bin file is now built with systemd-hwdb rather than the deprecated “udevadm hwdb”. This may impact mappings where the same key is defined in multiple matching entries. The updated behavior will select the latest definition in case of conflict. In general, this should be a positive change, as the hwdb source files are designed with this ordering in mind. As an example, the mapping of the HP Dev One keyboard scan code for “mute mic” is corrected by this update. This change may impact users who have worked-around previously incorrect mappings.Kime has been updated from 2.5.6 to 3.0.2 and the
i18n.inputMethod.kime.configoption has been removed. Users should usedaemonModules,iconColor, andextraConfigoptions underi18n.inputMethod.kimeinstead.tuthas been updated from 1.0.34 to 2.0.0, and now uses the TOML format for the configuration file instead of INI. Additional information can be found here.i3status-rusthas been updated from 0.22.0 to 0.30.5, and this brings many changes to its configuration format. Additional information can be found here.The
wordpressderivation no longer contains any built-in plugins or themes. If you need them, you have to add them back to prevent your site from breaking. You can find them inwordpressPackages.{plugins,themes}.llvmPackages_rocm.llvmwill not containclangorcompiler-rt.llvmPackages_rocm.clangwill not containllvm.llvmPackages_rocm.clangNoCompilerRthas been removed in favor of usingllvmPackages_rocm.clang-unwrapped.services.xserver.desktopManager.plasma5.excludePackageshas been moved toenvironment.plasma5.excludePackages, for consistency with other Desktop Environments.teleporthas been updated from major version 10 to major version 12. Please see upstream upgrade instructions and release notes for versions 11 and 12. Note that Teleport does not officially support upgrades across more than one major version at a time. If you’re running Teleport server components, it is recommended to first upgrade to an intermediate 11.x version by settingservices.teleport.package = pkgs.teleport_11. Afterwards, this option can be removed to upgrade to the default version (12).The EC2 image module previously detected and automatically mounted ext3-formatted instance store devices and partitions in stage-1 (initramfs), storing
/tmpon the first discovered device. This behaviour, which only catered to very specific use cases and could not be disabled, has been removed. Users relying on this should provide their own implementation, and probably use ext4 and perform the mount in stage-2.The EC2 image module previously detected and activated swap-formatted instance store devices and partitions in stage-1 (initramfs). This behaviour has been removed. Users relying on this should provide their own implementation.
gitlabhas been upgraded from major version 15 to major version 16 and requires at least PostgreSQL 13.6. Check the upgrade guide in the NixOS manual on how to upgrade your PostgreSQL installation.gitlab16 deprecates the use of external container registries, in our casepkgs.docker-distribution. Module users who haveservices.gitlab.registry.enableset totrueare advised to back up their state and switch to gitlab’s fork by settingservices.gitlab.registry.packagetopkgs.gitlab-container-registry.fail2banhas been updated to 1.0.2, which has a few breaking changes compared to 0.11.2 (changelog for 1.0.1, changelog for 1.0.2)alberthas been updated from 0.17.6 to 0.20.13, and 0.18.0 changed the config format and many plugins (changelog for 0.18.0)dokuwikihas been updated from 2023-07-31a (Igor) to 2023-04-04 (Jack Jackrum), which has completely removed the options to embed HTML and PHP for security reasons. The htmlok plugin can be used to regain this functionality.The old unsupported version 6.x of the ELK-stack and Elastic beats have been removed. Use OpenSearch instead.
The
cosmocpackage has been removed. The upstream scripts incosmoccshould be used instead.Qt 5.12 and 5.14 have been removed, as the corresponding branches have been EOL upstream for a long time. This affected under 10 packages in nixpkgs, largely unmaintained upstream as well, however, out-of-tree package expressions may need to be updated manually.
The services.wordpress.sites.<name>.plugins and services.wordpress.sites.<name>.themes options have been converted from sets to attribute sets to allow for consumers to specify explicit install paths via attribute name.
protonmail-bridgepackage has been updated to major version 3.Nebula now runs as a system user and group created for each nebula network, using the
CAP_NET_ADMINambient capability on launch rather than starting as root. Ensure that any files each Nebula instance needs to access are owned by the correct user and group, by defaultnebula-${networkName}.The
i18n.inputMethod.fcitxoption has been replaced withi18n.inputMethod.fcitx5because fcitx 4pkgs.fcitxhas been removed.In
mastodonit is now necessary to specify location of file withPostgreSQLdatabase password. Inservices.mastodon.database.passwordFileparameter default value/var/lib/mastodon/secrets/db-passwordhas been changed tonull.The
nix.readOnlyStoreoption has been renamed toboot.readOnlyNixStoreto clarify that it configures the NixOS boot process, not the Nix daemon.The latest available version of Nextcloud is v26 (available as
pkgs.nextcloud26) which uses PHP 8.2 as interpreter by default. The installation logic is as follows:If
system.stateVersionis >=23.05,pkgs.nextcloud26will be installed by default.If
system.stateVersionis >=22.11,pkgs.nextcloud25will be installed by default.Please note that an upgrade from v24 (or older) to v26 directly is not possible. Please upgrade to
nextcloud25(or earlier) first. Nextcloud prohibits skipping major versions while upgrading. You can upgrade by declaringservices.nextcloud.package = pkgs.nextcloud25;.It’s recommended to use the latest version available (i.e. v26) and to specify that using
services.nextcloud.package.
.NET 5.0 and .NET 3.1 were removed due to being end-of-life, use a newer, supported .NET version. Visit the Support Policy for more information.
The iputils package, which is installed by default, no longer provides the
ninfod,rarpdandrdisctools. See upstream’s release notes for more details and available replacements.The ppp plugin
rp-pppoe.sohas been renamed topppoe.soin ppp 2.4.9. Starting from ppp 2.5.0, there is no longer an alias for backwards compatibility. Configurations that use this plugin must be updated accordingly fromplugin rp-pppoe.sotoplugin pppoe.so. See upstream change.services.xserver.videoDrivers now defaults to the
modesettingdriver over device-specific ones. Theradeon,amdgpuandnouveaudrivers are still available, but effectively unmaintained and not recommended for use. Note that this does not affect your regular graphics drivers; this only concerns the DDX component of the driver, which most people are not relying on.services.xserver.libinput.enable is now set by default, enabling the more actively maintained and consistently behaved input device driver.
To enable the HTTP3 (QUIC) protocol for a nginx virtual host, set the
quicattribute on it to true, e.g.services.nginx.virtualHosts.<name>.quic = true;.In
services.fail2ban,bantime-increment.<name>options now default tonull(exceptbantime-increment.enable) and are used to set the corresponding option injail.localonly if notnull. Also, enforce thatbantime-increment.formulaandbantime-increment.multipliersare not both specified.The default
asteriskpackage was changed to v20 from v19. Asterisk versions 16 and 19 have been dropped due to being EOL. You may need to update /var/lib/asterisk to match the template files in${asterisk-20}/var/lib/asterisk.conntrack helper autodetection has been removed from kernels 6.0 and up upstream, and an assertion was added to ensure things don’t silently stop working. Migrate your configuration to assign helpers explicitly or use an older LTS kernel branch as a temporary workaround.
The
services.pipewire.configoptions have been removed, as they have basically never worked correctly. All behavior defined by the default configuration can be overridden with drop-in files as necessary - see below for details.The catch-all
hardware.video.hidpi.enableoption was removed. Users on high density displays may want to:Set
services.xserver.upscaleDefaultCursorto upscale the default X11 cursor for higher resolutionsAdjust settings under
fonts.fontconfigaccording to preferenceAdjust
console.fontaccording to preference, though the kernel will generally choose a reasonably sized font
services.pipewire.media-sessionand thepipewire-media-sessionpackage have been removed, as they are no longer supported upstream. Users are encouraged to useservices.pipewire.wireplumberinstead.The
bagetpackage and module was removed due to being unmaintained.The
qlandkartegtandgarmindevpackages were removed due to being unmaintained and insecure.The
go-ethereumpackage has been updated to v1.11.5 and thepuppethcommand is no longer available as of v1.11.0.The
pnpmpackage has be updated to from version 7.29.1 to version 8.1.1 and Node.js 14 support has been discontinued (though, there are workarounds if Node.js 14 is still required)The
zplugpackage changes its output path from$outto$out/share/zplug. Users should update their dependency on${pkgs.zplug}/init.zshto${pkgs.zplug}/share/zplug/init.zsh.The
pict-rspackage was updated from an 0.3 alpha release to 0.3 stable, and related environment variables now require two underscores instead of one.The
shattered-pixel-dungeongame was updated from 1.1.2 to 2.0.2.The location of game data has changed. To migrate it, run
mv ~/.shatteredpixel ~/.local/share/.shatteredpixelThe update will delete all your in-progress games.
espansohas been updated to major version 2. Therefore, migration steps may need to be performed. See the official migration instructions for how to perform these migrations. Further,espanso-waylandcan now be used for Wayland support.Only
k3sversion 1.26 is included. Users of thek3s_1_24ork3s_1_25packages should upgrade to use the1.26version of the package.The
nerdfontspackage has been updated to major version 3, which includes potential breaking changes.
Other Notable Changes
To follow RFC 0042 a few options of
opensshhave been moved fromextraConfigto the new freeform optionsettingsand renamed, e.g.:services.openssh.forwardX11toservices.openssh.settings.X11Forwardingservices.openssh.kbdInteractiveAuthentication->services.openssh.settings.KbdInteractiveAuthenticationservices.openssh.passwordAuthenticationtoservices.openssh.settings.PasswordAuthenticationservices.openssh.useDnstoservices.openssh.settings.UseDnsservices.openssh.permitRootLogintoservices.openssh.settings.PermitRootLoginservices.openssh.logLeveltoservices.openssh.settings.LogLevelservices.openssh.kexAlgorithmstoservices.openssh.settings.KexAlgorithmsservices.openssh.macstoservices.openssh.settings.Macsservices.openssh.cipherstoservices.openssh.settings.Ciphersservices.openssh.gatewayPortstoservices.openssh.settings.GatewayPorts
vim_configurablehas been renamed tovim-fullto avoid confusion:vim-full’s build-time features are configurable, but bothvimandvim-fullare customizable (in the sense of user configuration, like vimrc).Pantheon now defaults to Mutter 43 and GNOME settings daemon 43, all Pantheon packages are now tracking elementary OS 7 updates.
The module for the application firewall
opensnitchgot the ability to configure rules. Available as services.opensnitch.rulesThe module
usbmuxdnow has the ability to change the package used by the daemon. In case you’re experiencing issues withusbmuxdyou can try an alternative program likeusbmuxd2. Available as services.usbmuxd.packagenetboxwas updated to 3.5. NixOS’services.netbox.packagestill defaults to 3.3 ifstateVersionis earlier than 23.05. Please review upstream’s breaking changes for 3.4.0 and for 3.5.0, and upgrade NetBox by changingservices.netbox.package. Database migrations will be run automatically.services.netboxnow support RFC42-style options, throughservices.netbox.settings.services.mastodongained a tootctl wrapped namedmastodon-tootctlsimilar tonextcloud-occwhich can be executed from any user and switches to the configured mastodon user with sudo and sources the environment variables.services.borgmaticnow allows for multiple configurations, placed in/etc/borgmatic.d/, you can define them withservices.borgmatic.configurations.service.openafsServerfeatures a new backup serverpkgs.fabsas a replacement for openafs’s ownbuserver. See FABS to check if this is an viable replacement. It stores backups as volume dump files and thus better integrates into contemporary backup solutions.services.maddygot several updates:Configuration of users and their credentials using
services.maddy.ensureCredentials.TLS configuration is now possible via
services.maddy.tlswith two loaders present: ACME and file based.
The
dnsmasqservice now takes configuration via theservices.dnsmasq.settingsattribute set. The optionservices.dnsmasq.extraConfigwill be deprecated when NixOS 22.11 reaches end of life.The
dokuwikiservice is now configured viaservices.dokuwiki.sites.<name>.settingsattribute set;extraConfighas been removed. The{aclUse,superUser,disableActions}attributes have been renamed accordingly.pluginsConfignow only accepts an attribute set of booleans. Passing plain PHP is no longer possible. Same applies toaclwhich now also only accepts structuredsettings.The
zshpackage changes the way to set environment variables on NixOS systems whereprograms.zsh.enableequalsfalse. It now sources/etc/set-environmentwhen reading the system-levelzshenvfile. Before, it sourced/etc/profilewhen reading the system-levelzprofilefile.The
wordpressservice now takes configuration via theservices.wordpress.sites.<name>.settingsattribute set,extraConfigis still available to append additional text towp-config.php.To reduce closure size in
nixos/modules/profiles/minimal.nixprofile disabled installation documentations and manuals. Also disabledlogrotateandudisks2services.To reduce closure size in
nixos/modules/installer/netboot/netboot-minimal.nixprofile disabled load linux firmwares, pre-installing the complete stdenv andnetworking.wirelessservice.The minimal ISO image now uses the
nixos/modules/profiles/minimal.nixprofile.NixOS installer ISOs can now be built for
powerpc64le-linux; seenixos/modules/installer/sd-card/sd-image-powerpc64le.nixand PR 192672. Hydra does not support this platform, so you must build the binaries yourself.The
ghcWithPackagesandghcWithHooglewrappers will now also symlink GHC’s and all included libraries’ documentation to$out/share/docfor convenience. If undesired, the old behavior can be restored by overriding the builders with{ installDocumentation = false; }.The nftables module now validates its ruleset at build time. The new
networking.nftables.checkRulesetoption allows disabling this check, which may fail when rules have very specific requirements, that the sandbox environment, by default, will not cover. Thenetworking.nftables.preCheckRulesetoption can be used to prepare the environment before the checks are run.The
services.mastodonmodule now supports connection to a remotePostgreSQLdatabase.services.nextcloud.database.createLocallynow uses socket authentication and is no longer compatible with password authentication.If you want the module to manage the database for you, unset
services.nextcloud.config.dbpassFile(andservices.nextcloud.config.dbhost, if it’s set).If you want to use password authentication and create the database locally, you will have to use
services.mysqlto set it up.
services.nextcloud.config.objectstore.s3.sseCKeyFileis a new option to enable server-side encryption with customer provided keys (SSE-C) for your S3 in Nextcloud.NixOS swap partitions with random encryption can now control the sector size, cipher, and key size used to set up the plain encryption device over the underlying block device rather than allowing them to be determined by
cryptsetup(8). One can use these features like so:{ swapDevices = [ { device = "/dev/disk/by-partlabel/swapspace"; randomEncryption = { enable = true; cipher = "aes-xts-plain64"; keySize = 512; sectorSize = 4096; }; } ]; }New option
security.pam.zfsto enable unlocking and mounting of encrypted ZFS home dataset at login.services.peertubenow requires you to specify the secret filesecrets.secretsFile. It can be generated by runningopenssl rand -hex 32. Before upgrading, check the release notes for PeerTube v5.0.0.And backup your data.services.chronydis now started with additional systemd sandbox/hardening options for better security.PostgreSQL has added opt-in support for JIT compilation. It can be enabled like this:
{ services.postgresql.enableJIT = true; }services.netdataoffers aservices.netdata.deadlineBeforeStopSecoption which will control the deadline (in seconds) after which systemd will consider your netdata instance as dead if it didn’t start in the elapsed time. It is helpful when your netdata instance takes longer to start because of a large amount of state or upgrades.services.dhcpcdservice stopped soliciting or accepting IPv6 Router Advertisements on interfaces that use static IPv6 addresses. If your network provides both IPv6 unique local addresses (ULA) and globally unique addresses (GUA) through autoconfiguration with SLAAC, you must add the parameternetworking.dhcpcd.IPv6rs = true;.The module
services.headscalewas refactored to be compliant with RFC 0042. To be precise, this means that the following things have changed:Most settings have been migrated below services.headscale.settings which is a freeform attribute-set that will be converted into headscale’s YAML config format. This means that the configuration from headscale’s example configuration can be directly written as attribute-set in Nix within this option.
services.kubonow unmountsipfsMountDirandipnsMountDireven if it is killed unexpectedly whenautoMountis enabled.services.grafanalistens only on localhost by default again. This was changed to the upstream default of0.0.0.0by accident in the freeform setting conversion.Grafana Tempo has been updated to version 2.0. See the upstream upgrade guide for migration instructions.
A new
virtualisation.rosettamodule was added to allow runningx86_64binaries through Rosetta inside virtualised NixOS guests on Apple Silicon. This feature works by default with the UTM virtualisation package.The new option
users.motdFileallows configuring a Message Of The Day that can be updated dynamically.The
rootpackage is now built with the"-Dgnuinstall=ON"CMake flag, making the output conform thebinlibsharelayout. In this layout,tutorialsis undershare/doc/ROOT/;cmake,font,icons,jsandmacroundershare/root;Makefile.compandMakefile.configunderetc/root.There are various new options in the
services.nginxmodule:Enabling global redirect in
services.nginx.virtualHostsnow allows one to add exceptions with thelocationsoption.The
proxyCachePathoption has been added toservices.nginx. It allows configuring theproxy_cache_path, that configures the storage path and various other settings for the cache.A new option
recommendedBrotliSettingshas been added toservices.nginx. Learn more about compression in Brotli format here.services.nginx.recommendedProxySettingsnow removes theConnectionheader preventing clients from closing backend connections.
The nginx module also received an update to
services.nginx.recommendedGzipSettings:Enables gzip compression for only certain proxied requests.
Allow checking and loading of precompressed files.
Updated gzip mime-types.
Increased the minimum length of a response that will be gzipped.
Garage version is based on system.stateVersion, existing installations will keep using version 0.7. New installations will use version 0.8. In order to upgrade a Garage cluster, please follow upstream instructions and configure services.garage.package.
Nebula now supports the
services.nebula.networks.<name>.isRelayandservices.nebula.networks.<name>.relaysconfiguration options for setting up or allowing traffic relaying. See the announcement for more details about relays.Resilio sync secret keys can now be provided using a secrets file at runtime, preventing these secrets from ending up in the Nix store.
The
firewallandnatmodules can now optionally rely on an nftables based implementation. Enablenetworking.nftablesto use it.The
services.fwupdmodule now allows arbitrary daemon settings to be configured in a structured manner (services.fwupd.daemonSettings).services.xserver.desktopManager.plasma5.phononBackendnow defaults to vlc according to upstrean recommendationThe
zramSwapis now implemented withzram-generator, and the optionzramSwap.numDevicesfor using ZRAM devices as general purpose ephemeral block devices has been removed.As Singularity has renamed to Apptainer to distinguish from an un-renamed fork by Sylabs Inc., there are now two packages of Singularity/Apptainer:
apptainer: Fromgithub.com/apptainer/apptainer, which is the new repo after renaming.singularity: Fromgithub.com/sylabs/singularity, which is the fork by Sylabs Inc…
singularity-tools.buildImagegot a new input argumentsingularityto specify which package to use.The new option
programs.singularity.enableFakeroot, if set totrue, provides--fakerootsupport forapptainerandsingularity.The new option
services.tailscale.useRoutingFeaturescontrols various settings for using Tailscale features like exit nodes and subnet routers. If you wish to use your machine as an exit node, you can set this setting toserver, otherwise if you wish to use an exit node you can set this setting toclient. The strict RPF warning has been removed as the RPF will be loosened automatically based on the value of this setting.openjdkfrom version 11 and above is not build withopenjfx(i.e.: JavaFX) support by default anymore. You can re-enable it by overriding, e.g.:openjdk11.override { enableJavaFX = true; };.Xastir can now access AX.25 interfaces via the
libax25package.nixos-versionnow accepts--configuration-revisionto display more information about the current generation revisionThe option
services.nomad.extraSettingsPluginshas been fixed to allow more than one plugin in the path.The option
services.prometheus.exporters.pihole.intervaldoes not exist anymore and has been removed.The option
services.gpsd.devicehas been replaced withservices.gpsd.devices, which supports multiple devices.k3scan now be configured with anEnvironmentFilefor its systemd service, allowing secrets to be provided without ending up in the Nix Store.The
giteamodule options have been moved into a freeform attribute set belowservices.gitea.settings.boot.initrd.luks.device.<name>has a newtryEmptyPassphraseoption, this is useful for OEMs who need to install an encrypted disk with a future settable passphraseThe
bindmodule now allows the per-zoneallow-querysetting to be configured (previously it was hard-coded toany; it still defaults toanyto retain compatibility).The option
services.jitsi-videobridge.apishas been renamed tocolibriRestApiand turned into a boolean. Setting it totruewill enable the private rest API, useful for monitoring usingservices.prometheus.exporters.jitsi.enable. Learn more about the API: “The COLIBRI control interface (/colibri/)”.Booting from a volume managed by the Stratis storage management daemon is now supported. Use
fileSystems.<name>.stratis.poolUuidto configure the pool containing the fs.
Nixpkgs internals
buildDunePackagenow defaults tostrictDeps = truewhich means that any library should go intobuildInputsorcheckInputs. Any executable that is run on the building machine should go intonativeBuildInputsornativeCheckInputsrespectively. Example of executables areocaml,findlibandmenhir. PPXs are libraries which are built by dune and should therefore not go intonativeBuildInputs.buildFHSUserEnvis now calledbuildFHSEnvand uses FlatPak’s Bubblewrap sandboxing tool rather than Nixpkgs’ own chrootenv. The old chrootenv-based implementation is still available viabuildFHSEnvChrootbut is considered deprecated and will be removed when the remaining uses inside Nixpkgs have been migrated. If your FHSEnv-wrapped application misbehaves when using the new bubblewrap implementation, please create an issue in Nixpkgs.Top-level
buildPlatform,hostPlatform,targetPlatformhave been deprecated, usestdenv.Xinstead.carnixandcratesIOhas been removed due to being unmaintained, use alternatives such as naersk and crate2nix instead.checkInputshave been renamed tonativeCheckInputs, because they behave the same asnativeBuildInputswhendoCheckis set.checkInputsnow denote a new type of dependencies, added tobuildInputswhendoCheckis set. As a rule of thumb,nativeCheckInputsare tools on$PATHused during the tests, andcheckInputsare libraries which are linked to executables built as part of the tests. Similarly,installCheckInputsare renamed tonativeInstallCheckInputs, corresponding tonativeBuildInputs, andinstallCheckInputsare a new type of dependencies added tobuildInputswhendoInstallCheckis set. (Note that this change will not cause breakage to derivations withstrictDepsunset, which are most packages except python, rust, ocaml and go packages).DocBook option documentation, which has been deprecated since 22.11, will now cause a warning when documentation is built. Out-of-tree modules should migrate to using CommonMark documentation as outlined in the section called “Option Declarations” to silence this warning.
DocBook option documentation support will be removed in the next release and CommonMark will become the default. DocBook option documentation that has not been migrated until then will no longer render properly or cause errors.
lib.systems.examples.ghcjsand consequentlypkgsCross.ghcjsnow use the target tripletjavascript-unknown-ghcjsinstead ofjs-unknown-ghcjs. This has been done to match an upstream decision to follow Cabal’s platform naming more closely. Nixpkgs will also rejectjsas an architecture name.Lisp gained a manual section, documenting a new and backwards incompatible interface. The previous interface will be removed in a future release.
Calling
makeSetupHookwithout passing anameargument is deprecated.nixos/lib/make-disk-image.nixhandlescontentsarguments that are directories better, fixing a bug where it used to put them in a subdirectory of the intendedtarget.nixos/lib/make-disk-image.nixcan now mutate EFI variables, run user-provided EFI firmware or variable templates. This is now extensively documented in the NixOS manual.Nixpkgs now uses IEEE-standard floating point arithmetic on
powerpc64le-linux.Deprecated
xlibsWrappertransitional package has been removed in favour of direct use of its constituents:xorg.libX11,freetypeand others.
Detailed migration information
Pipewire configuration overrides
Why this change?
The Pipewire config semantics don’t really match the NixOS module semantics, so it’s extremely awkward to override the default config, especially when lists are involved. Vendoring the configuration files in nixpkgs also creates unnecessary maintenance overhead.
Also, upstream added a lot of accommodations to allow doing most of the things you’d want to do with a config edit in better ways.
Migrating your configuration
Compare your settings to the defaults and where your configuration differs from them.
Then, create a drop-in JSON file in /etc/pipewire/<config file name>.d/99-custom.conf (the actual filename can be anything) and migrate your changes to it according to the following sections.
Repeat for every file you’ve modified, changing the directory name accordingly.
Things you can just copy over
If you are:
setting properties via
*.propertiesloading a new module to
context.modulescreating new objects with
context.objectsdeclaring SPA libraries with
context.spa-libsrunning custom commands with
context.execadding new rules with
*.rulesrunning custom PulseAudio commands with
pulse.cmd
Move the definitions into the drop-in.
Note that the use of context.exec is not recommended and other methods of running your thing are likely a better option.
{
"context.properties": {
"your.property.name": "your.property.value"
},
"context.modules": [
{ "name": "libpipewire-module-my-cool-thing" }
],
"context.objects": [
{ "factory": { ... } }
],
"alsa.rules": [
{ "matches: { ... }, "actions": { ... } }
]
}
Removing a module from context.modules
Look for an option to disable it via context.properties ("module.x11.bell": "false" is likely the most common use case here).
If one is not available, proceed to Nuclear option.
Modifying a module’s parameters in context.modules
For most modules (e.g. libpipewire-module-rt) it’s enough to load the module again with the new arguments, e.g.:
{
"context.modules": [
{
"name": "libpipewire-module-rt",
"args": {
"rt.prio": 90
}
}
]
}
Note that module-rt specifically will generally use the highest values available by default, so setting limits on the pipewire systemd service is preferable to reloading.
If reloading the module is not an option, proceed to Nuclear option.
Nuclear option
If all else fails, you can still manually copy the contents of the default configuration file
from ${pkgs.pipewire}/share/pipewire to /etc/pipewire and edit it to fully override the default.
However, this should be done only as a last resort. Please talk to the Pipewire maintainers if you ever need to do this.
Release 22.11 (“Raccoon”, 2022.11/30)
The NixOS release team is happy to announce a new version of NixOS 22.11. NixOS is a Linux distribution, whose set of packages can also be used on other Linux systems and macOS.
This release is supported until the end of June 2023, handing over to NixOS 23.05.
To upgrade to the latest release follow the upgrade chapter.
Highlights
In addition to numerous new and upgraded packages, this release includes the following highlights:
Software that uses the
cryptpassword hashing API is now using the implementation provided bylibxcryptinstead of glibc’s, which enables support for more secure algorithms.Support for algorithms that
libxcryptdoes not consider strong are deprecated as of this release, and will be removed in NixOS 23.05.This includes system login passwords. Given this, we strongly encourage all users to update their system passwords, as you will be unable to login if password hashes are not migrated by the time their support is removed.
When using
users.users.<name>.hashedPasswordto configure user passwords, runmkpasswd, and use the yescrypt hash that is provided as the new value.On the other hand, for interactively configured user passwords, re-set the passwords for all users with
passwd.This release introduces warnings for the use of deprecated hash algorithms for both methods of configuring passwords. To make sure you migrated correctly, run
nixos-rebuild switch.
The NixOS documentation is now generated from markdown. While docbook is still part of the documentation build process, it’s a big step towards the full migration.
aarch64-linuxis now included in thenixos-22.11andnixos-22.11-smallchannels. This means that when those channel update, bothx86_64-linuxandaarch64-linuxwill be available in the binary cache.aarch64-linuxISOs are now available on the downloads page.nsncdis now available as a replacement ofnscd.nscdis responsible for resolving hostnames, users and more in NixOS and has been a long standing source of bugs, such as sporadic network freezes.More context in this issue.
Help us test the new implementation by setting
services.nscd.enableNsncdtotrue.We plan to use
nsncdby default in NixOS 23.05.Linode cloud images are now supported by importing
${modulesPath}/virtualisation/linode-image.nixand accessingsystem.build.linodeImageon the output.hardware.nvidiahas a new option,hardware.nvidia.open, that can be used to enable the usage of NVIDIA’s open-source kernel driver. Note that the driver’s support for GeForce and Workstation GPUs is still alpha quality, see the release announcement for more information.The
emacspackage now makes use of native compilation which means:Emacs packages from Nixpkgs, builtin or not, will do native compilation ahead of time so you can enjoy the benefit of native compilation without compiling them on you machine;
Emacs packages from somewhere else, e.g.
package-install, will perform asynchronously deferred native compilation. If you do not want this, maybe to avoid CPU consumption for compilation, you can use(setq native-comp-deferred-compilation nil)to disable it while still benefiting from native compilation for packages from Nixpkgs.
Internal changes
Haskell
ghcWithPackagesis now up to 15 times faster to evaluate, thanks to changinglib.closePropagationfrom a quadratic to linear complexity. Please see backward incompatibilities notes below. https://github.com/NixOS/nixpkgs/pull/194391For cross-compilation targets that can also run on the building machine, we now run tests. This, for example, is the case for the
pkgsStaticandpkgsLLVMpackage sets or i686 packages onx86_64machines.To simplify cross-compilation in NixOS, this release introduces the
nixpkgs.hostPlatformandnixpkgs.buildPlatformoptions. These cover and override thenixpkgs.{system,localSystem,crossSystem}options.hostPlatformis the platform or “system” string of the NixOS system described by the configuration.buildPlatformis the platform that is responsible for building the NixOS configuration. It defaults to thehostPlatform, for a non-cross build configuration. To cross compile, setbuildPlatformto a different value.
The new options convey the same information, but with fewer options, and following the Nixpkgs terminology.
The existing options
nixpkgs.{system,localSystem,crossSystem}have not been formally deprecated, to allow for evaluation of the change and to allow for a transition period so that in time the ecosystem can switch without breaking compatibility with any supported NixOS release.
Notable version updates
Nix has been upgraded from v2.8.1 to v2.11.0. For more information, please see the release notes for 2.9, 2.10 and 2.11.
OpenSSL now defaults to OpenSSL 3, updated from 1.1.1.
GNOME has been upgraded to version 43. Please see the release notes for details.
KDE Plasma has been upgraded from v5.24 to v5.26. Please see the release notes for v5.25 and v5.26 for more details on the included changes.
Cinnamon has been updated to 5.4, and the Cinnamon module now defaults to Blueman as the Bluetooth manager and slick-greeter as the LightDM greeter, to match upstream.
PHP now defaults to PHP 8.1, updated from 8.0.
Perl has been updated to 5.36, and its core module
HTTP::Tinywas patched to verify SSL/TLS certificates by default.Python now defaults to 3.10, updated from 3.9.
Backward Incompatibilities
Nixpkgs now requires Nix 2.3 or newer.
The
isCompatiblepredicate checking CPU compatibility is no longer exposed by the platform sets generated usinglib.systems.elaborate. In most cases you will want to use the newcanExecutepredicate instead which also takes the kernel / syscall interface into account.lib.systems.parse.isCompatiblestill exists, but has changed semantically: Architectures with differing endianness modes are no longer considered compatible.ngrokhas been upgraded from 2.3.40 to 3.0.4. Please see the upgrade guide and changelog. Notably, breaking changes are that the config file format has changed and support for single hyphen arguments was dropped.i18n.supportedLocalesis now only generated with the locales set ini18n.defaultLocaleandi18n.extraLocaleSettings.This reduces the final system closure size by up to 200MB.
If you require all locales installed, set the option to
[ "all" ].
Deprecated settings
logrotate.pathsandlogrotate.extraConfighave been removed. Please convert any uses to services.logrotate.settings instead.The
isPowerPCpredicate, found onplatformattrsets (hostPlatform,buildPlatform,targetPlatform, etc) has been removed in order to reduce confusion. The predicate was defined such that it matches only the 32-bit big-endian members of the POWER/PowerPC family, despite having a name which would imply a broader set of systems. If you were using this predicate, you can replacefoo.isPowerPCwith(with foo; isPower && is32bit && isBigEndian).The
fetchgitfetcher now uses cone mode by default for sparse checkouts. Non-cone mode can be enabled by passingnonConeMode = true, but note that non-cone mode is deprecated and this option may be removed alongside a future Git update without notice.The
fetchgitfetcher supports sparse checkouts via thesparseCheckoutoption. This used to accept a multi-line string with directories/patterns to check out, but now requires a list of strings.opensshwas updated to version 9.1, disabling the generation of DSA keys when usingssh-keygen -Aas they are insecure. Also,SetEnvdirectives inssh_configandsshd_configare now first-match-wins.bsp-layoutno longer uses the commandcycleto switch to other window layouts, as it got replaced by the commandspreviousandnext.The Barco ClickShare driver/client package
pkgs.clickshare-csc1and the optionprograms.clickshare-csc1.enablehave been removed, as it requiresqt4, which reached its end-of-life 2015 and will no longer be supported by nixpkgs. According to Barco many of their base unit models can be used with Google Chrome and the Google Cast extension.services.hbasehas been renamed toservices.hbase-standalone. For production HBase clusters, useservices.hadoop.hbaseinstead.The
p4package now only includes the open-source Perforce Helix Core command-line client and APIs. It no longer installs the unfree Helix Core Server binariesp4d,p4broker, andp4p. To install the Helix Core Server binaries, use thep4dpackage instead.The OpenSSL extension for the PHP interpreter used by Nextcloud is built against OpenSSL 1.1 if
system.stateVersionis below22.11. This is to make sure that people using server-side encryption don’t lose access to their files.In any other case, it’s safe to use OpenSSL 3 for PHP’s OpenSSL extension. This can be done by setting
services.nextcloud.enableBrokenCiphersForSSEtofalse.The
coqpackage and versioned variants starting atcoq_8_14no longer include CoqIDE, which is now available throughcoqPackages.coqide. It is still possible to get CoqIDE as part of thecoqpackage by overriding thebuildIdeargument of the derivation.PHP 7.4 is no longer supported due to upstream not supporting this version for the entire lifecycle of the 22.11 release.
The ipfs package and module were renamed to kubo. The kubo module now uses an RFC42-style
settingsoption instead ofextraConfigand thegatewayAddress,apiAddressandswarmAddressoptions were renamed. Using the old names will print a warning but still work.pkgs.cosigndoes not provide thecosignedbinary anymore. Thesgetbinary has been moved into its own package.Emacs now uses the Lucid toolkit by default instead of GTK because of stability and compatibility issues. Users who still wish to remain using GTK can do so by using
emacs-gtk.kanidmhas been updated to 1.1.0-alpha.10 and now requires a TLS certificate and key. It will always starthttpsand-–-if enabled-–-an LDAPS server and no HTTP and LDAP server anymore.riak package removed along with
services.riakmodule, due to lack of maintainer to update the package.ppd files in
pkgs.cups-drv-rastertosag-gdiare now gzipped. If you refer to such a ppd file with its path (e.g. via hardware.printers.ensurePrinters) you will need to append.gzto the path.xow package removed along with the
hardware.xowmodule, due to the project being deprecated in favor ofxone, which is available via thehardware.xonemodule.dd-agent package removed along with the
services.dd-agentmodule, due to the project being deprecated in favor ofdatadog-agent, which is available via theservices.datadog-agentmodule.teleporthas been upgraded to major version 10. Please see upstream upgrade instructions and release notes.lib.closePropagationnow needs that all gathered sets have anoutPathattribute.lemmy module option
services.lemmy.settings.database.createLocallymoved toservices.lemmy.database.createLocally.virtlyst package and
services.virtlystmodule removed, due to lack of maintainers.The
nix.checkConfigoption now fully disables the config check. The newnix.checkAllErrorsoption behaves likenix.checkConfigpreviously did.generateOptparseApplicativeCompletionsandgenerateOptparseApplicativeCompletionfromhaskell.lib.compose(andhaskell.lib) have been deprecated in favor ofgenerateOptparseApplicativeCompletions(plural!) as provided by the haskell package sets (sohaskellPackages.generateOptparseApplicativeCompletionsetc.). The latter allows for cross-compilation (by automatically disabling generation of completion in the cross case). For it to work properly you need to make sure that the function comes from the same context as the package you are trying to override, i.e. always use the same package set as your package is coming from or – even better – useself.generateOptparseApplicativeCompletionsif you are overriding a haskell package set. The old functions are retained for backwards compatibility, but yield are warning.The
services.graphite.apiandservices.graphite.beaconNixOS options, and thepython3.pkgs.graphite_api,python3.pkgs.graphite_beaconandpython3.pkgs.influxgraphpackages, have been removed due to lack of upstream maintenance.The
tracebinary fromperf-linuxpackage has been removed, due to being a duplicate of theperfbinary.The
awspackage has been removed due to being abandoned by the upstream. It is recommended to useawscliorawscli2instead.The CEmu TI-84 Plus CE emulator package has been renamed to
cemu-ti. The Cemu Wii U emulator is now packaged ascemu.systemd-networkdv250 deprecated, renamed, and moved some sections and settings which leads to the following breaking module changes:systemd.network.networks.<name>.dhcpV6PrefixDelegationConfigis renamed tosystemd.network.networks.<name>.dhcpPrefixDelegationConfig.systemd.network.networks.<name>.dhcpV6Configno longer accepts theForceDHCPv6PDOtherInformation=setting. Please use theWithoutRA=andUseDelegatedPrefix=settings in yoursystemd.network.networks.<name>.dhcpV6Configand theDHCPv6Client=setting in yoursystemd.network.networks.<name>.ipv6AcceptRAConfigto control when the DHCPv6 client is started and how the delegated prefixes are handled by the DHCPv6 client.systemd.network.networks.<name>.networkConfigno longer accepts theIPv6Token=setting. Use theToken=setting in yoursystemd.network.networks.<name>.ipv6AcceptRAConfiginstead. Thesystemd.network.networks.<name>.ipv6Prefixes.*.ipv6PrefixConfignow also accepts theToken=setting.
arangodbversions 3.3, 3.4, and 3.5 have been removed because they are at EOL upstream. The default is now 3.10.0. Support for aarch64-linux has been removed since the target cannot be built reproducibly. By defaultarangodbis now built for thehaswellarchitecture. If you wish to build for a different architecture, you may override thetargetArchitectureargument with a value from this list supported upstream. Some architecture specific optimizations are also conditionally enabled. You may alter this behavior by overriding theasmOptimizationsparameter. You may also add additional architecture support by adding more-DHAS_XYZflags tocmakeFlagsviaoverrideAttrs.The
meta.mainProgramattribute of packages inwineWowPackagesnow defaults to"wine64".The
paperlessmodule now defaultsPAPERLESS_TIME_ZONEto your configured system timezone.The top-level
termonad-with-packagesalias fortermonadhas been removed.Linux 4.9 has been removed because it will reach its end of life within the lifespan of 22.11.
(Neo)Vim can not be configured with
configure.pathogenanymore to reduce maintenance burden. Useconfigure.packagesinstead.Neovim can not be configured with plug anymore (still works for vim).
The
adguardhomemodule no longer useshostandportoptions, usesettings.bind_hostandsettings.bind_portinstead.The default
kopsversion is now 1.25.1 and support for 1.22 and older has been dropped.The
zreplpackage has been updated from 0.5.0 to 0.6.0. See the changelog for details.k3sno longer supports Docker as runtime due to upstream dropping support.cassandra_2_1andcassandra_2_2have been removed. Please update tocassandra_3_11orcassandra_3_0. See the changelog for more information about the upgrade process.mysql57has been removed. Please update tomysql80ormariadb. See the upgrade guide for more information.Consequently,
cqrlogandamoroknow usemariadbinstead ofmysql57for their embedded databases. Runningmysql_upgrademay be necessary.k3ssupportsclusterInitoption, and it is enabled by default, for servers.percona-server56has been removed. Please migrate tomysqlormariadbif possible.obs-studiohase been updated to version 28. If you have packaged custom plugins, check if they are compatible.obs-websockethas been integrated intoobs-studio.signaldhas been bumped to0.23.0. For the upgrade, a migration process is necessary. It can be done by running a command like this before startingsignald.service:signald -d /var/lib/signald/db \ --database sqlite:/var/lib/signald/db \ --migrate-dataFor further information, please read the upstream changelogs.
styluano longer acceptslua52SupportandluauSupportoverrides. Usefeaturesinstead, which defaults to[ "lua54" "luau" ].ocamlPackages.ocaml_extlibhas been renamed toocamlPackages.extlib.pkgs.fetchNextcloudApphas been rewritten to circumvent impurities in e.g. tarballs from GitHub and to make it easier to apply patches. This means that your hashes are out-of-date and the (previously required) attributesnameandversionare no longer accepted.The Syncthing service now only allows absolute paths—starting with
/or~/—forservices.syncthing.folders.<name>.path. In a future release other paths will be allowed again and interpreted relative toservices.syncthing.dataDir.services.github-runnerandservices.github-runners.<name>gained the optionserviceOverrideswhich allows overriding the systemdserviceConfig. If you have been overriding the systemd service configuration (i.e., by definingsystemd.services.github-runner.serviceConfig), you have to use theserviceOverridesoption now. Example:{ services.github-runner.serviceOverrides.SupplementaryGroups = [ "docker" ]; }
Other Notable Changes
PHP is now built in
NTS(Non-Thread Safe) mode by default.For Apache and
mod_phpusage, we enableZTS(Zend Thread Safe) mode. This has been a common practice for a long time in other distributions.
firefox,thunderbirdandlibrewolfnow come with Wayland support by default. Thefirefox-wayland,firefox-esr-wayland,thunderbird-waylandandlibrewolf-waylandattributes are obsolete and have been aliased to their generic attribute.The
xplrpackage has been updated from 0.18.0 to 0.19.0, which brings some breaking changes. See the upstream release notes for more details.Configuring multiple GitHub runners is now possible through
services.github-runners.<name>. The options underservices.github-runnerremain, to configure a single runner.github-runnergained support for ephemeral runners and registrations using a personal access token (PAT) instead of a registration token. Seeservices.github-runner.ephemeralandservices.github-runner.tokenFilefor details.A new module was added to provide hardware support for the Saleae Logic device family, providing the options
hardware.saleae-logic.enableandhardware.saleae-logic.package.ZFS module will no longer allow hibernation by default.
This is a safety measure to prevent data loss cases like the ones described at OpenZFS/260 and OpenZFS/12842.
Use the
boot.zfs.allowHibernationoption to configure this behaviour.
Mastodon now automatically removes remote media attachments older than 30 days. This is configurable through
services.mastodon.mediaAutoRemove.The Redis module now disables RDB persistence when
services.redis.servers.<name>.save = []instead of using the Redis default.Neo4j was updated from version 3 to version 4. See upstream’s migration guide for information on how to migrate your instance.
The
networking.wireguardmodule now can set the mtu on interfaces and tag its packets with an fwmark.The option
overrideStrategywas added to the different systemd unit options (systemd.services.<name>,systemd.sockets.<name>, …) to allow enforcing the creation of a dropin file, rather than the main unit file, by setting it toasDropin. This is useful in cases where the existence of the main unit file is not known to Nix at evaluation time, for example when the main unit file is provided by adding a package tosystemd.packages. See the fix proposed in NixOS’s systemd abstraction doesn’t work with systemd template units for an example.The
polymcpackage has been removed due to a rogue maintainer. It has been replaced byprismlauncher, a fork by the rest of the maintainers. For more details, see the PR that made this change and the issue detailing the vulnerability. Users with existing installations should rename~/.local/share/polymcto~/.local/share/PrismLauncher. The main config file’s path has also moved from~/.local/share/polymc/polymc.cfgto~/.local/share/PrismLauncher/prismlauncher.cfg.The
bloatpackage has been updated from unstable-2022-03-31 to unstable-2022-10-25, which brings a breaking change. See this upstream commit message for details.Synapse’s systemd unit has been hardened.
The module
services.grafanawas refactored to be compliant with RFC 0042. To be precise, this means that the following things have changed:The newly introduced option
services.grafana.settingsis an attribute-set that will be converted into Grafana’s INI format. This means that the configuration from Grafana’s configuration reference can be directly written as attribute-set in Nix within this option.The option
services.grafana.extraOptionshas been removed. This option was an association of environment variables for Grafana. If you had an expression like{ services.grafana.extraOptions.SECURITY_ADMIN_USER = "foobar"; }your Grafana instance was running with
GF_SECURITY_ADMIN_USER=foobarin its environment.For the migration, it is recommended to turn it into the INI format, i.e. to declare
{ services.grafana.settings.security.admin_user = "foobar"; }instead.
The keys in
services.grafana.extraOptionshave the format<INI section name>_<Key Name>. Further details are outlined in the configuration reference.Alternatively you can also set all your values from
extraOptionstosystemd.services.grafana.environment, make sure you don’t forget to add theGF_prefix though!Previously, the options services.grafana.provision.datasources and services.grafana.provision.dashboards expected lists of datasources or dashboards for the declarative provisioning.
To declare lists of
datasources, please rename your declarations to services.grafana.provision.datasources.settings.datasources.
dashboards, please rename your declarations to services.grafana.provision.dashboards.settings.providers.
This change was made to support more features for that:
It’s possible to declare the
apiVersionof your dashboards and datasources by services.grafana.provision.datasources.settings.apiVersion (or services.grafana.provision.dashboards.settings.apiVersion).Instead of declaring datasources and dashboards in pure Nix, it’s also possible to specify configuration files (or directories) with YAML instead using services.grafana.provision.datasources.path (or services.grafana.provision.dashboards.path. This is useful when having provisioning files from non-NixOS Grafana instances that you also want to deploy to NixOS.
Note: secrets from these files will be leaked into the store unless you use a file-provider or env-var for secrets!
services.grafana.provision.notifiersis not affected by this change because this feature is deprecated by Grafana and will probably be removed in Grafana 10. It’s recommended to useservices.grafana.provision.alerting.contactPointsinstead.
The
services.grafana.provision.alertingoption was added. It includes suboptions for every alerting-related objects (with the exception ofnotifiers), which means it’s now possible to configure modern Grafana alerting declaratively.Synapse now requires entries in the
state_group_edgestable to be unique, in order to prevent accidentally introducing duplicate information (for example, because a database backup was restored multiple times). If your Synapse database already has duplicate rows in this table, this could fail with an error and require manual remediation.The
diamondpackage has been update from 0.8.36 to 2.0.15. See the upstream release notes for more details.The
guakepackage has been updated from 3.6.3 to 3.9.0, see the changelog for more details.The
netlify-clipackage has been updated from 6.13.2 to 12.2.4, see the changelog for more details.dockerTools.buildImage’scontentsparameter has been deprecated in favor ofcopyToRoot. UsecopyToRoot = buildEnv { ... };or similar if you intend to add packages to/bin.The
proxmox.qemuConf.biosoption was added, it corresponds toHardware->BIOSfield in Proxmox web interface. Use"ovmf"value to build UEFI image, default value remains"bios". New optionproxmox.partitionTableTypedefaults to either"legacy"or"efi", depending on thebiosvalue. SettingpartitionTableTypeto"hybrid"results in an image, which supports both methods ("bios"and"ovmf"), thereby remaining bootable after change to ProxmoxHardware->BIOSfield.memtest86+ was updated from 5.00-coreboot-002 to 6.00-beta2. It is now the upstream version from https://www.memtest.org/, as coreboot’s fork is no longer available.
Option descriptions, examples, and defaults writing in DocBook are now deprecated. Using CommonMark is preferred and will become the default in a future release.
The
documentation.nixos.options.allowDocBookoption was added to ease the transition to CommonMark option documentation. Setting this option tofalsecauses an error for every option included in the manual that uses DocBook documentation; it defaults totrueto preserve the previous behavior and will be removed once the transition to CommonMark is complete.The Redis module now persists each instance’s configuration file in the state directory, in order to support some more advanced use cases like Sentinel.
protonuphas been aliased to and replaced byprotonup-ngdue to upstream not maintaining it.The udisks2 service, available at
services.udisks2.enable, is now disabled by default. It will automatically be enabled through services and desktop environments as needed. This also means that polkit will now actually be disabled by default. The default forsecurity.polkit.enablewas already flipped in the previous release, but udisks2 being enabled by default re-enabled it.Nextcloud has been updated to version 25. Additionally the following things have changed for Nextcloud in NixOS:
For Nextcloud >=24, the default PHP version is 8.1.
Nextcloud 23 has been removed since it will reach its end of life in December 2022.
If
system.stateVersionis >=22.11, Nextcloud 25 will be installed by default. For older versions, Nextcloud 24 will be installed.Please ensure that you only upgrade one major release at a time! Nextcloud doesn’t support upgrades across multiple versions, i.e. an upgrade from 23 to 25 is only possible when upgrading to 24 first.
systemd-oomd is enabled by default. Depending on which systemd units have
ManagedOOMSwap=killorManagedOOMMemoryPressure=kill, systemd-oomd will SIGKILL all the processes under the appropriate descendant cgroups when the configured limits are exceeded. NixOS does currently not configure cgroups with oomd by default, this can be enabled using systemd.oomd.enableRootSlice, systemd.oomd.enableSystemSlice, and systemd.oomd.enableUserServices.The
tt-rssservice performs two database migrations when you first use its web UI after upgrade. Consider backing up its database before updating.The
pass-secret-servicepackage now includes systemd units from upstream, so adding it to the NixOSservices.dbus.packagesoption will make it start automatically as a systemd user service when an application tries to talk to the libsecret D-Bus API.The Wordpress module now has support for installing language packs through a new option,
services.wordpress.sites.<site>.languages.The default package for
services.mullvad-vpn.packagewas changed topkgs.mullvad, allowing cross-platform usage of Mullvad.pkgs.mullvadonly contains the Mullvad CLI tool, so users who rely on the Mullvad GUI will want to change it back topkgs.mullvad-vpn, or addpkgs.mullvad-vpnto their environment.PowerDNS has been updated from v4.6.2 to v4.7.2. Please be sure to review the Upgrade Notes provided by upstream before upgrading. Worth specifically noting is that the new Catalog Zones feature comes with a mandatory schema change for the GSQL database backends, which has to be manually applied.
There is a new module for the
thunarprogram (the Xfce file manager), which depends on thexfconfdbus service, and also has a dbus service and a systemd unit. The optionservices.xserver.desktopManager.xfce.thunarPluginshas been renamed toprograms.thunar.plugins, and may be removed in a future release.There is a new module for
xfconf(the Xfce configuration storage system), which has a dbus service.The Mastodon package has been upgraded to v4.0.0. See the v4.0.0 release notes for a list of changes. On standard setups, no manual migration steps are required. Nevertheless, a database backup is recommended.
The
nomadpackage now defaults to v1.3, which no longer has a downgrade path to v1.2 or older.The
nodePackagespackage set now defaults to the LTS release in thenodejspackage again, instead of being pinned tonodejs-14_x. Several updates to node2nix have been made for compatibility with newer Node.js and npm versions and a newpostRebuildhook has been added for packages to perform extra build steps before the npm install step prunes dev dependencies.boot.kernel.sysctlis defined as a freeformType and adds a custom merge option fornet.core.rmem_max(taking the highest value defined to avoid conflicts between 2 services trying to set that value).The
mamepackage does not ship with its tools anymore in the default output. They were moved to a separatetoolsoutput instead. For convenience,mame-toolspackage was added for those who want to use it.A NixOS module for Firefox has been added which allows preferences and policies to be set. This also allows extensions to be installed via the
ExtensionSettingspolicy. The new options are underprograms.firefox.The option
services.picom.experimentalBackendswas removed since it is now the default and the option will causepicomto quit instead.haskellPackages.callHackageis not always invalidated ifall-cabal-hasheschanges, leading to less rebuilds of haskell dependencies.haskellPackages.callHackageandhaskellPackages.callCabal2nix(and related functions) no longer keep a reference to thecabal2nixcall used to generate them. As a result, they will be garbage collected more often.
New Services
alps, a simple and extensible webmail. Available as services.alps.
appvm, Nix based app VMs. Available as virtualisation.appvm.
AusweisApp2, the authentication software for the German ID card. Available as programs.ausweisapp.
automatic-timezoned. a Linux daemon to automatically update the system timezone based on location. Available as services.automatic-timezoned.
Dolibarr, an enterprise resource planning and customer relationship manager. Enable using services.dolibarr.
dragonflydb, a modern replacement for Redis and Memcached. Available as services.dragonflydb.
endlessh-go, an SSH tarpit that exposes Prometheus metrics. Available as services.endlessh-go.
endlessh, an SSH tarpit. Available as services.endlessh.
EVCC is an EV charge controller with PV integration. It supports a multitude of chargers, meters, vehicle APIs and more and ties that together with a well-tested backend and a lightweight web frontend. Available as services.evcc.
expressvpn, the CLI client for ExpressVPN. Available as services.expressvpn.
FreshRSS, a free, self-hostable RSS feed aggregator. Available as services.freshrss.
Garage, a simple object storage server for geodistributed deployments, alternative to MinIO. Available as services.garage.
go-autoconfig, IMAP/SMTP autodiscover server. Available as services.go-autoconfig.
Grafana Tempo, a distributed tracing store. Available as services.tempo.
HBase cluster, a distributed, scalable, big data store. Available as services.hadoop.hbase.
infnoise, a hardware True Random Number Generator dongle. Available as services.infnoise.
kanata, a tool to improve keyboard comfort and usability with advanced customization. Available as services.kanata.
karma, an alert dashboard for Prometheus Alertmanager. Available as services.karma
Komga, a free and open source comics/mangas media server. Available as services.komga.
kthxbye, an alert acknowledgement management daemon for Prometheus Alertmanager. Available as services.kthxbye
languagetool, a multilingual grammar, style, and spell checker. Available as services.languagetool.
Listmonk, a self-hosted newsletter manager. Enable using services.listmonk.
Mepo, a fast, simple, hackable OSM map viewer for mobile and desktop Linux. Available as programs.mepo.enable.
merecat, a small and easy HTTP server based on thttpd. Available as services.merecat
netbird, a zero configuration VPN. Available as services.netbird.
ntfy.sh, a push notification service. Available as services.ntfy-sh
OpenRGB, a FOSS tool for controlling RGB lighting. Available as services.hardware.openrgb.enable.
Outline, a wiki and knowledge base similar to Notion. Available as services.outline.
Patroni, a template for PostgreSQL HA with ZooKeeper, etcd or Consul. Available as services.patroni.
persistent-evdev, a daemon to add virtual proxy devices that mirror a physical input device but persist even if the underlying hardware is hot-plugged. Available as services.persistent-evdev.
Please, a Sudo clone written in Rust. Available as security.please.
Prometheus IPMI exporter, an IPMI exporter for Prometheus. Available as services.prometheus.exporters.ipmi.
Sachet, an SMS alerting tool for the Prometheus Alertmanager. Available as services.prometheus.sachet.
schleuder, a mailing list manager with PGP support. Enable using services.schleuder.
syncstorage-rs, a self-hostable sync server for Firefox. Available as services.firefox-syncserver.
Tandoor Recipes, a self-hosted multi-tenant recipe collection. Available as services.tandoor-recipes.
TAYGA, an out-of-kernel stateless NAT64 implementation. Available as services.tayga.
tmate-ssh-server, server side part of tmate. Available as services.tmate-ssh-server.
Uptime Kuma, a fancy self-hosted monitoring tool. Available as services.uptime-kuma.
WriteFreely, a simple blogging platform with ActivityPub support. Available as services.writefreely.
xray, a fully compatible v2ray-core replacement. Features XTLS, which when enabled on server and client, brings UDP FullCone NAT to proxy setups. Available as services.xray.
Release 22.05 (“Quokka”, 2022.05/30)
Support is planned until the end of December 2022, handing over to 22.11.
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
Nix has been updated from 2.3 to 2.8. This mainly brings experimental support for Flakes, but also marks the
nixcommand as experimental which now has to be enabled via the configuration explicitly. For more information and instructions for upgrades, see the release notes for nix-2.4, nix-2.5, nix-2.6, nix-2.7 and nix-2.8The
firefoxbrowser onx86_64-linuxnow makes use of profile-guided optimisation, resulting in a much more responsive browsing experience.GNOME has been upgraded to 42. Please take a look at their Release Notes for details. In particular, it replaces gedit with GNOME Text Editor, GNOME Terminal with GNOME Console (formerly King’s Cross) and GNOME Screenshot by a tool integrated into the Shell.
PHP 8.1 is now available.
systemd services can now set systemd.services.<name>.reloadTriggers instead of
reloadIfChangedfor a more granular distinction between reloads and restarts.Systemd has been upgraded to the version 250.
Pulseaudio has been updated to version 15.0 and now optionally supports additional Bluetooth audio codecs such as aptX or LDAC, with codec switching available in
pavucontrol. This feature is disabled by default, but can be enabled with the optionhardware.pulseaudio.package = pkgs.pulseaudioFull;. Existing third-party modules that offered similar functions, such aspulseaudio-modules-btorpulseaudio-hsphfpd, are obsolete and have been removed.PostgreSQL now defaults to major version 14.
Module authors can use
mkRenamedOptionModuleWithto automate the deprecation cycle without annoying out-of-tree module authors and their users.The default GHC version has been updated from 8.10.7 to 9.0.2.
pkgs.haskellPackagesandpkgs.ghcwill now use this version by default.The GNOME and Plasma installation CDs now use
pkgs.calamaresandpkgs.calamares-nixos-extensionsto allow users to easily install and set up NixOS with a GUI.security.acme.defaultshas been added to simplify the configuration of settings for many certificates at once. This also opens up the option to use DNS-01 validation when usingenableACMEweb server virtual hosts (e.g.services.nginx.virtualHosts.*.enableACME).
New Services
1password, command-lines and graphic interface for 1Password. Available as programs._1password and programs._1password-gui.
aesmd, the Intel SGX Architectural Enclave Service Manager. Available as services.aesmd.
agate, a very simple server for the Gemini hypertext protocol. Available as services.agate.
apfs, a kernel module for mounting the Apple File System (APFS).
argonone, a replacement daemon for the Raspberry Pi Argon One power button and cooler. Available at services.hardware.argonone.
ArchiSteamFarm, a C# application with primary purpose of idling Steam cards from multiple accounts simultaneously. Available as services.archisteamfarm.
BaGet, a lightweight NuGet and symbol server. Available at services.baget.
bird-lg, a BGP looking glass for Bird Routing. Available as services.bird-lg.
blocky, fast and lightweight DNS proxy as ad-blocker for local network with many features. Available as services.blocky.
cloudflare-dyndns, CloudFlare Dynamic DNS client. Available as services.cloudflare-dyndns.
Corosync and Pacemaker, A open-source high availability resource manager. Available as services.corosync and services.pacemaker.
create_ap, a module for creating wifi hotspots using the program linux-wifi-hotspot. Available as services.create_ap.
Envoy, a high-performance reverse proxy. Available as services.envoy.
ergochat, a modern IRC with IRCv3 features. Available as services.ergochat.
ethercalc, an online collaborative spreadsheet. Available as
services.ethercalc.filebeat, a lightweight shipper for forwarding and centralizing log data. Available as services.filebeat.
FRRouting, a popular suite of Internet routing protocol daemons (BGP, BFD, OSPF, IS-IS, VRRP and others). Available as services.frr.
Grafana Mimir, an open source, horizontally scalable, highly available, multi-tenant, long-term storage for Prometheus. Available as services.mimir.
Haste, a pastebin written in node.js. Available as services.haste.
headscale, an Open Source implementation of the Tailscale Control Server. Available as services.headscale.
heisenbridge, a bouncer-style Matrix IRC bridge. Available as services.heisenbridge.
https-dns-proxy, DNS to DNS over HTTPS (DoH) proxy. Available as services.https-dns-proxy.
input-remapper, an easy to use tool to change the mapping of your input device buttons. Available at services.input-remapper.
InvoicePlane, web application for managing and creating invoices. Available at services.invoiceplane.
k3b, the KDE disk burning application. Available as programs.k3b.
K40-Whisperer, a program to control cheap Chinese laser cutters. Available as programs.k40-whisperer.enable. Users must add themselves to the
k40group to be able to access the device.kanidm, an identity management server written in Rust. Available as services.kanidm (renamed to
services.kanidm.server.enablein 26.05).Maddy, a free an open source mail server. Available as services.maddy.
matrix-conduit, a simple, fast and reliable chat server powered by matrix. Available as services.matrix-conduit.
Moosefs, fault tolerant petabyte distributed file system. Available as moosefs.
mozillavpn, the client for the Mozilla VPN service. Available as services.mozillavpn.
mtr-exporter, a Prometheus exporter for mtr metrics. Available as services.mtr-exporter.
nbd, a Network Block Device server. Available as services.nbd.
netbox, infrastructure resource modeling (IRM) tool. Available as services.netbox.
nethoscope, listen to your network traffic. Available as programs.nethoscope.
nifi, an easy to use, powerful, and reliable system to process and distribute data. Available as services.nifi.
nix-ld, Run unpatched dynamic binaries on NixOS. Available as programs.nix-ld.
NNCP, NNCP (Node to Node copy) utilities and configuration, Available as programs.nncp.
pgadmin4, an admin interface for the PostgreSQL database. Available at services.pgadmin.
PowerDNS-Admin, a web interface for the PowerDNS server. Available at services.powerdns-admin.
prometheus-pve-exporter, a tool that exposes information from the Proxmox VE API for use by Prometheus. Available as services.prometheus.exporters.pve.
prosody-filer, a server for handling XMPP HTTP Upload requests. Available at services.prosody-filer.
Public Inbox, an “archives first” approach to mailing lists. Available as services.public-inbox.
r53-ddns, a small tool to run your own DDNS service via AWS Route53. Available as services.r53-ddns.
rmfakecloud, a clone of the cloud sync the remarkable tablet. Available as services.rmfakecloud.
rootless Docker, a
systemd --userDocker service which runs without root permissions. Available as virtualisation.docker.rootless.enable.rstudio-server, a browser-based version of the RStudio IDE for the R programming language. Available as services.rstudio-server.
mediamtx, ready-to-use RTSP / RTMP / HLS server and proxy that allows to read, publish and proxy video and audio streams. Available as services.mediamtx.
Snipe-IT, a free open source IT asset/license management system. Available as services.snipe-it.
snowflake-proxy, a system to defeat internet censorship. Available as services.snowflake-proxy.
sslmate-agent, a daemon for managing SSL/TLS certificates on a server. Available as services.sslmate-agent.
starship, a minimal, blazing-fast, and infinitely customizable prompt for any shell. Available at programs.startship.
systembus-notify, allow system level notifications to reach the users. Available as services.systembus-notify. Please keep in mind that this service should only be enabled on machines with fully trusted users, as any local user is able to DoS user sessions by spamming notifications.
teleport, allows engineers and security professionals to unify access for SSH servers, Kubernetes clusters, web applications, and databases across all environments. Available at services.teleport.
tetrd, share your internet connection from your device to your PC and vice versa through a USB cable. Available at services.tetrd.
uptermd, an open-source solution for sharing terminal sessions instantly over the public internet via secure tunnels. Available at services.uptermd.
usbrelayd, an USB Relay MQTT daemon. Available as services.usbrelayd.
webdav-server-rs, Webdav server in rust. Available as services.webdav-server-rs.
wg-netmanager, the Wireguard network manager. Available as services.wg-netmanager.
Zammad, a web-based, open source user support/ticketing solution. Available as services.zammad.
Backward Incompatibilities
pkgs.ghcnow refers topkgs.targetPackages.haskellPackages.ghc. This only makes a difference if you are cross-compiling and will ensure thatpkgs.ghcalways runs on the host platform and compiles for the target platform (similar topkgs.gccfor example).haskellPackages.ghcstill behaves as before, running on the build platform and compiling for the host platform (similar tostdenv.cc). This means you don’t have to adjust your derivations if you usehaskellPackages.callPackage, but when usingpkgs.callPackageand takingghcas an input, you should now usebuildPackages.ghcinstead to ensure cross compilation keeps working (or switch tohaskellPackages.callPackage).pkgs.ghc.withPackagesas well ashaskellPackages.ghcWithPackagesetc. now needs be overridden directly, as opposed to overriding the result of calling it. Additionally, thewithLLVMparameter has been renamed touseLLVM. So instead of(ghc.withPackages (p: [])).override { withLLVM = true; }, one needs to use(ghc.withPackages.override { useLLVM = true; }) (p: []).The update of the haskell package set brings with it a new version of the
xmonadmodule, which will break your configuration if you uselaunchas entrypoint. The example code the corresponding nixos module was adjusted, you may want to have a look at it.The
home-assistantmodule now requires users that don’t want their configuration to be managed declaratively to setservices.home-assistant.config = null;. This is required due to the way default settings are handled with the new settings style.Additionally the default list of
extraComponentsnow includes the minimal dependencies to successfully complete the onboarding procedure.pkgs.emacsPackages.orgPackagesis removed because org elpa is deprecated. The packages in the top level ofpkgs.emacsPackages, such as org and org-contrib, refer to the ones inpkgs.emacsPackages.elpaPackagesandpkgs.emacsPackages.nongnuPackageswhere the new versions will release.The configuration and state directories used by
nixos-containershave been moved from/etc/containersand/var/lib/containersto/etc/nixos-containersand/var/lib/nixos-containers.If you are changing
system.stateVersionto"22.05"manually on an existing system you are responsible for migrating these directories yourself.This is to improve compatibility with
libcontainerbased software such as Podman and Skopeo which assumes they have ownership over/etc/containers.lib.systems.supportedhas been removed, as it was overengineered for determining the systems to support in the nixpkgs flake. The list of systems exposed by the nixpkgs flake can now be accessed aslib.systems.flakeExposed.For new installations
virtualisation.oci-containers.backendis now set topodmanby default. If you still want to use Docker on systems wheresystem.stateVersionis set to to"22.05"setvirtualisation.oci-containers.backend = "docker";.Old systems with olderstateVersions stay with “docker”.security.klogdwas removed. Logging of kernel messages is handled by systemd since Linux 3.5.pkgs.ssmtphas been dropped due to the program being unmaintained.pkgs.msmtpcan be used instead as a substitutesendmailimplementation. The corresponding optionsservices.ssmtp.*have been removed as well.programs.msmtp.*can be used instead for an equivalent setup. For example:{ # Original ssmtp configuration: services.ssmtp = { enable = true; useTLS = true; useSTARTTLS = true; hostName = "smtp.example:587"; authUser = "someone"; authPassFile = "/secrets/password.txt"; }; # Equivalent msmtp configuration: programs.msmtp = { enable = true; accounts.default = { tls = true; tls_starttls = true; auth = true; host = "smtp.example"; port = 587; user = "someone"; passwordeval = "cat /secrets/password.txt"; }; }; }services.kubernetes.addons.dashboardwas removed due to it being an outdated version.services.kubernetes.scheduler.{port,address}now set--secure-portand--bind-addressinstead of--portand--address, since the former have been deprecated and are no longer functional in kubernetes>=1.23. Ensure that you are not relying on the insecure behaviour before upgrading.In the PowerDNS Recursor module (
services.pdns-recursor), default values of several IP address-related NixOS options have been updated to match the default upstream behavior. In particular, Recursor by default will:listen on (and allows connections from) both IPv4 and IPv6 addresses (
services.pdns-recursor.dns.address,services.pdns-recursor.dns.allowFrom);allow only local connections to the REST API server (
services.pdns-recursor.api.allowFrom).
In the ncdns module, the default value of
services.ncdns.addresshas been changed to the IPv6 loopback address (::1).openldap(and therefore the slapd LDAP server) were updated to version 2.6.2. The project introduced backwards-incompatible changes, namely the removal of the bdb, hdb, ndb, and shell backends in slapd. Therefore before updating, dump your databaseslapcat -n 1in LDIF format, and reimport it after updating yourservices.openldap.settings, which represents yourcn=config.Additionally with 2.5 the argon2 module was included in the standard distribution and renamed from
pw-argon2toargon2. Remember to update yourolcModuleLoadentry incn=config.opensshhas been update to 8.9p1, changing the FIDO security key middleware interface.gitno longer hardcodes the path to openssh’ ssh binary to reduce the amount of rebuilds. If you are using git with ssh remotes and do not have a ssh binary in your environment consider addingopensshto it or switching togitFull.services.k3s.enableno longer impliessystemd.enableUnifiedCgroupHierarchy = false, and will default to the ‘systemd’ cgroup driver when usingservices.k3s.docker = true. This change may require a reboot to take effect, and k3s may not be able to run if the boot cgroup hierarchy does not match its configuration. The previous behavior may be retained by explicitly settingsystemd.enableUnifiedCgroupHierarchy = falsein your configuration.fonts.fontsno longer includes ancient bitmap fonts when bothconfig.services.xserver.enableandconfig.nixpkgs.config.allowUnfreeare enabled. If you still want these fonts, use:{ fonts.fonts = [ pkgs.xorg.fontbhlucidatypewriter100dpi pkgs.xorg.fontbhlucidatypewriter75dpi pkgs.xorg.fontbh100dpi ]; }services.prometheus.alertManagerTimeouthas been removed as it has been deprecated upstream and has no effect.The DHCP server (
services.dhcpd4,services.dhcpd6) has been hardened. The service is now using the systemd’sDynamicUsermechanism to run as an unprivileged dynamically-allocated user with limited capabilities. The dhcpd state files are now always stored in/var/lib/dhcpd{4,6}and theservices.dhcpd4.stateDirandservice.dhcpd6.stateDiroptions have been removed. If you were depending on root privileges or set{uid,gid,cap} binaries in dhcpd shell hooks, you may give dhcpd more capabilities with e.g.systemd.services.dhcpd6.serviceConfig.AmbientCapabilities.The
mailpileemail webclient (services.mailpile) has been removed due to its reliance on python2.services.ipfs.extraFlagsis now escaped withutils.escapeSystemdExecArgs. If you rely on systemd interpolatingextraFlagsin the serviceExecStart, this will no longer work.hbaseversion 0.98.24 has been removed. The package now defaults to version 2.4.11. Versions 1.7.1 and 3.0.0-alpha-2 are also available.services.paperless-ngwas renamed toservices.paperless. Accordingly, thepaperless-ng-managescript (located indataDir) was renamed topaperless-manage.services.paperlessnow usespaperless-ngx.The
matrix-synapseservice (services.matrix-synapse) has been converted to use thesettingsoption defined in RFC42. This means that options that are part of yourhomeserver.yamlconfiguration, and that were specified at the top-level of the module (services.matrix-synapse) now need to be moved intoservices.matrix-synapse.settings. And while not all options you may use are defined in there, they are still supported, because you can set arbitrary values in this freeform type.The
listeners.*.bind_addressoption was renamed tobind_addressesin order to match the upstreamhomeserver.yamloption name. It is now also a list of strings instead of a string.An example to make the required migration clearer:
Before:
{ services.matrix-synapse = { enable = true; server_name = "example.com"; public_baseurl = "https://example.com:8448"; enable_registration = false; registration_shared_secret = "xohshaeyui8jic7uutuDogahkee3aehuaf6ei3Xouz4iicie5thie6nohNahceut"; macaroon_secret_key = "xoo8eder9seivukaiPh1cheikohquuw8Yooreid0The4aifahth3Ou0aiShaiz4l"; tls_certificate_path = "/var/lib/acme/example.com/fullchain.pem"; tls_certificate_path = "/var/lib/acme/example.com/fullchain.pem"; listeners = [ { port = 8448; bind_address = ""; type = "http"; tls = true; resources = [ { names = [ "client" ]; compress = true; } { names = [ "federation" ]; compress = false; } ]; } ]; }; }After:
{ services.matrix-synapse = { enable = true; # this attribute set holds all values that go into your homeserver.yaml configuration # See https://github.com/matrix-org/synapse/blob/develop/docs/sample_config.yaml for # possible values. settings = { server_name = "example.com"; public_baseurl = "https://example.com:8448"; enable_registration = false; # pass `registration_shared_secret` and `macaroon_secret_key` via `extraConfigFiles` instead tls_certificate_path = "/var/lib/acme/example.com/fullchain.pem"; tls_certificate_path = "/var/lib/acme/example.com/fullchain.pem"; listeners = [ { port = 8448; bind_addresses = [ "::" "0.0.0.0" ]; type = "http"; tls = true; resources = [ { names = [ "client" ]; compress = true; } { names = [ "federation" ]; compress = false; } ]; } ]; }; extraConfigFiles = [ "/run/keys/matrix-synapse/secrets.yaml" ]; }; }The secrets in your original config should be migrated into a YAML file that is included via
extraConfigFiles. The filename must be quoted to prevent nix from copying it to the (world readable) store.Additionally a few option defaults have been synced up with upstream default values, for example the
max_upload_sizegrew from10Mto50M. For the same reason, the defaultmedia_store_pathwas changed from${dataDir}/mediato${dataDir}/media_storeifsystem.stateVersionis at least22.05. Files will need to be manually moved to the new location if thestateVersionis updated.As of Synapse 1.58.0, the old groups/communities feature has been disabled by default. It will be completely removed with Synapse 1.61.0.
The Keycloak package (
pkgs.keycloak) has been switched from the Wildfly version, which will soon be deprecated, to the Quarkus based version. The Keycloak service (services.keycloak) has been updated to accommodate the change and now differs from the previous version in a few ways:services.keycloak.extraConfighas been removed in favor of the new settings-styleservices.keycloak.settingsoption. The available options correspond directly to parameters inconf/keycloak.conf. Some of the most important parameters are documented as suboptions, the rest can be found in the All configuration section of the Keycloak Server Installation and Configuration Guide. While the new configuration is much simpler and cleaner than the old JBoss CLI one, this unfortunately mean that there’s no straightforward way to convert an old configuration to the new format and some settings may not even be available anymore.services.keycloak.frontendUrlwas removed and the frontend URL is now configured through thehostnamefamily of settings inservices.keycloak.settingsinstead. See the Hostname section of the Keycloak Server Installation and Configuration Guide for more details. Additionally,/authwas removed from the default context path and needs to be added back inservices.keycloak.settings.http-relative-pathif you want to keep compatibility with your current clients.services.keycloak.bindAddress,services.keycloak.forceBackendUrlToFrontendUrl,services.keycloak.httpPortandservices.keycloak.httpsPorthave been removed in favor of their equivalent options inservices.keycloak.settings.httpPortandhttpsPorthave additionally had their types changed fromstrtoport.The new names are as follows:
bindAddress:services.keycloak.settings.http-hostforceBackendUrlToFrontendUrl:services.keycloak.settings.hostname-strict-backchannelhttpPort:services.keycloak.settings.http-porthttpsPort:services.keycloak.settings.https-port
For example, when using a reverse proxy the migration could look like this:
Before:
{ services.keycloak = { enable = true; httpPort = "8080"; frontendUrl = "https://keycloak.example.com/auth"; database.passwordFile = "/run/keys/db_password"; extraConfig = { "subsystem=undertow"."server=default-server"."http-listener=default".proxy-address-forwarding = true; }; }; }After:
{ services.keycloak = { enable = true; settings = { http-port = 8080; hostname = "keycloak.example.com"; http-relative-path = "/auth"; proxy = "edge"; }; database.passwordFile = "/run/keys/db_password"; }; }The MoinMoin wiki engine (
services.moinmoin) has been removed, because Python 2 is being retired from nixpkgs.Services in the
hadoopmodule previously setopenFirewallto true by default. This has now been changed to false. Node definitions for multi-node clusters would needopenFirewall = true;to be added to to hadoop services when upgrading from NixOS 21.11.services.hadoop.yarn.nodemanagernow uses cgroup-based CPU limit enforcement by default. Additionally, the optionuseCGroupswas added to nodemanagers as an easy way to switch back to the old behavior.The
wafHookhook now honorsNIX_BUILD_CORESwhenenableParallelBuildingis not set explicitly. Packages can restore the old behaviour by settingenableParallelBuilding=false.pkgs.claws-mail-gtk2, representing Claws Mail’s older release version three, was removed in order to get rid of Python 2. Please switch toclaws-mail, which is Claws Mail’s latest release based on GTK+3 and Python 3.The
writers.writePython2and correspondingwriters.writePython2Binconvenience functions to create executable Python 2 scripts in the store were removed in preparation of removal of the Python 2 interpreter. Scripts have to be converted to Python 3 for use withwriters.writePython3orwriters.writePyPy2needs to be used.buildGoModulewas updated to usego_1_17, third party derivations that specify >= go 1.17 in the maingo.modwill need to regenerate theirvendorSha256hash.The
gnome-passwordsafepackage updated to version 6.x and renamed tognome-secrets.services.gnome.experimental-features.realtime-schedulingoption has been removed, as GNOME Shell now uses rtkit. Usesecurity.rtkit.enable = true;instead. As before, you will need to have it enabled using GSettings.services.telepathywill no longer be enabled by default for GNOME desktops, one should enable it in their configs if using Empathy or Polari.If you previously used
/etc/docker/daemon.json, you need to incorporate the changes into the new optionvirtualisation.docker.daemon.settings.Ntopng (
services.ntopng) is updated to 5.2.1 and uses a separate Redis instance ifsystem.stateVersionis at least22.05. Existing setups shouldn’t be affected.The backward compatibility in
services.wordpressto configure sites with the old interface has been removed. Please useservices.wordpress.sitesinstead.The backward compatibility in
services.dokuwikito configure sites with the old interface has been removed. Please useservices.dokuwiki.sitesinstead.opensmtpd-extras is no longer build with python2 scripting support due to python2 deprecation in nixpkgs
services.miniflux.adminCredentialFilesis now required, instead of defaulting toadminandpassword.The
taskservermodule no longer implicitly opens ports in the firewall configuration. This is now controlled through the optionservices.taskserver.openFirewall.The
autoresticpackage has been upgraded from 1.3.0 to 1.5.0 which introduces breaking changes in config file, check their migration guide for more details.teleporthas been upgraded to major version 9. Please see upstream upgrade instructions and release notes.For
pkgs.python3.pkgs.ipython, its direct dependencypkgs.python3.pkgs.matplotlib-inline(which is really an adapter to integrate matplotlib in ipython if it is installed) does not depend onpkgs.python3.pkgs.matplotlibanymore. This is closer to a non-Nix install of ipython. This has the added benefit to reduce the closure size ofipythonfrom ~400MB to ~160MB (including ~100MB for python itself).documentation.manhas been refactored to support choosing a man implementation other than GNU’sman-db. For this,documentation.man.manualPageshas been renamed todocumentation.man.man-db.manualPages. If you want to use the new alternative man implementationmandoc, adddocumentation.man = { enable = true; man-db.enable = false; mandoc.enable = true; }to your configuration.Normal users (with
isNormalUser = true) which have non-emptysubUidRangesorsubGidRangesset no longer have additional implicit ranges allocated. To enable automatic allocation back setautoSubUidGidRange = true.idris2now requires--packagewhen using packagescontribandnetwork, while previously these idris2 packages were automatically loaded.The iputils package, which is installed by default, no longer provides the legacy tools
tftpdandtraceroute6. More tools (ninfod,rarpd, andrdisc) are going to be removed in the next release. See upstream’s release notes for more details and available replacements.services.thelounge.privatewas removed in favor ofservices.thelounge.public, to follow with upstream changes.pkgs.docbookrxwas removed since it’s unmaintainedpkgs._7zzis now correctly licensed as LGPL3+ and BSD3 with optional unfree unRAR licensed codeThe
vim.customizefunction produced byvimUtils.makeCustomizablenow has a slightly different interface:The wrapper now includes everything in the given Vim derivation if
nameis"vim"(the default). This makes thewrapManualargument obsolete, but this behavior can be overridden by setting thestandaloneargument.All the executables present in the given derivation (or, in
standalonemode, only the*vimones) are wrapped. This makes thewrapGuiargument obsolete.The
vimExecutableNameandgvimExecutableNamearguments were replaced by a singleexecutableNameargument in which the shell variable$execan be used to refer to the wrapped executable’s name.
See the comments in
pkgs/applications/editors/vim/plugins/vim-utils.nixfor more details.vimUtils.vimWithRCwas removed. You should instead usecustomizeon a Vim derivation, which now acceptsvimrcFileandgvimrcFilearguments.tilp2was removed together with its moduleThe F-PROT antivirus (
fprotpackage) and its service module were removed because it reached end-of-life.bird1and its modulesservices.birdas well asservices.bird6have been removed. Upgrade toservices.bird2.The options
networking.interfaces.<name>.ipv4.routesandnetworking.interfaces.<name>.ipv6.routesare no longer ignored when using networkd instead of the default scripted network backend by settingnetworking.useNetworkdtotrue.The
millerpackage has been upgraded from 5.10.3 to 6.2.0. See What’s new in Miller 6.MultiMC has been replaced with the fork PrismLauncher due to upstream developers being hostile to 3rd party package maintainers. PrismLauncher removes all MultiMC branding and is aimed at providing proper 3rd party packages like the one contained in Nixpkgs. This change affects the data folder where game instances and other save and configuration files are stored. Users with existing installations should rename
~/.local/share/multimcto~/.local/share/PrismLauncher. The main config file’s path has also moved from~/.local/share/multimc/multimc.cfgto~/.local/share/PrismLauncher/prismlauncher.cfg.systemd-nspawn@.servicesettings have been reverted to the default systemd behaviour. User namespaces are now activated by default. If you want to keep running nspawn containers without user namespaces you need to setsystemd.nspawn.<name>.execConfig.PrivateUsers = falsesystemd-shutdownis now properly linked on shutdown to unmount all filesystems and device mapper devices cleanly. This can be disabled usingsystemd.shutdownRamfs.enable.The Tor SOCKS proxy is now actually disabled if
services.tor.client.enableis set tofalse(the default). If you are using this functionality but didn’t change the setting or set it tofalse, you now need to set it totrue.services.github-runnerhas been hardened. Notably address families and system calls have been restricted, which may adversely affect some kinds of testing, e.g. usingAF_BLUETOOTHto test bluetooth devices.The terraform 0.12 compatibility has been removed and the
terraform.withPluginsandterraform-providers.mkProviderimplementations simplified. Providers now need to be stored under$out/libexec/terraform-providers/<registry>/<owner>/<name>/<version>/<os>_<arch>/terraform-provider-<name>_v<version>(which mkProvider does).This breaks back-compat so it’s not possible to mix-and-match with previous versions of nixpkgs. In exchange, it now becomes possible to use the providers from nixpkgs-terraform-providers-bin directly.
The
dendritepackage has been upgraded from 0.5.1 to 0.6.5. Instances configured with split sqlite databases, which has been the default in NixOS, require merging of the federation sender and signing key databases. See upstream release notes on version 0.6.0 for details on database changes.The existing
pkgs.opentelemetry-collectorhas been moved topkgs.opentelemetry-collector-contribto match the actual source being the “contrib” edition.pkgs.opentelemetry-collectoris now the actual core release of opentelemetry-collector. If you use the community contributions you should change the package you refer to. If you don’t need them update your commands fromotelcontribcoltootelcorecoland enjoy a 7x smaller binary.services.zookeeperhas a new optionjrefor specifying the JRE to start zookeeper with. It defaults to the JRE thatpkgs.zookeeperwas wrapped with, instead ofpkgs.jre. This changes the JRE topkgs.jdk11_headlessby default.pkgs.pgadminnow refers topkgs.pgadmin4.pgadmin3has been removed.pkgs.minetestclient_4andpkgs.minetestserver_4have been removed, as the last 4.x release was in 2018.pkgs.minetestclient(equivalent topkgs.minetest) andpkgs.minetestservercan be used instead.pkgs.noto-fonts-cjkis now deprecated in favor ofpkgs.noto-fonts-cjk-sansandpkgs.noto-fonts-cjk-serifbecause they each have different release schedules. To maintain compatibility with prior releases of Nixpkgs,pkgs.noto-fonts-cjkis currently an alias ofpkgs.noto-fonts-cjk-sansand doesn’t include serif fonts.pkgs.epgstationhas been upgraded from v1 to v2, resulting in incompatible changes in the database scheme and configuration format.Some top-level settings under services.epgstation is now deprecated because it was redundant due to the same options being present in services.epgstation.settings.
The option
services.epgstation.basicAuthwas removed because basic authentication support was dropped by upstream.The option services.epgstation.database.passwordFile no longer has a default value. Make sure to set this option explicitly before upgrading. Change the database password if necessary.
The services.epgstation.settings option now expects options for
config.ymlin EPGStation v2.Existing data for the services.epgstation module would have to be backed up prior to the upgrade. To back up existing data to
/tmp/epgstation.bak, runsudo -u epgstation epgstation run backup /tmp/epgstation.bak. To import that data after to the upgrade, runsudo -u epgstation epgstation run v1migrate /tmp/epgstation.bakswitch-to-configuration(the script that is run when runningnixos-rebuild switchfor example) has been reworkedThe interface that allows activation scripts to restart units has been streamlined. Restarting and reloading is now done by a single file
/run/nixos/activation-restart-listthat honorsrestartIfChangedandreloadIfChangedof the units.Preferring to reload instead of restarting can still be achieved using
/run/nixos/activation-reload-list.
The script now uses a proper ini-file parser to parse systemd units. Some values are now only searched in one section instead of in the entire unit. This is only relevant for units that don’t use the NixOS systemd moule.
RefuseManualStop,X-OnlyManualStart,X-StopOnRemoval,X-StopOnReconfigurationare only searched in the[Unit]sectionX-ReloadIfChanged,X-RestartIfChanged,X-StopIfChangedare only searched in the[Service]section
The
services.bookstack.cacheDiroption has been removed, since the cache directory is now handled by systemd.The
services.bookstack.extraConfigoption has been replaced byservices.bookstack.configwhich implements a settings-style configuration.lib.assertMsgandlib.assertOneOfno longer returnfalseif the passed condition isfalse,throwing the given error message instead (which makes the resulting error message less cluttered). This will not impact the behaviour of code using these functions as intended, namely as top-level wrapper forassertconditions.The
vpncpackage has been changed to use GnuTLS instead of OpenSSL by default for licensing reasons.The default version of
nextcloudis nextcloud24. Please note that it’s not possible to upgradenextcloudacross multiple major versions! This means it’s e.g. not possible to upgrade fromnextcloud22tonextcloud24in a single deploy and most21.11users will have to upgrade tonextcloud23first.pkgs.vimPlugins.onedark-nvimnow refers to navarasu/onedark.nvim (formerly refers to olimorris/onedarkpro.nvim).services.pipewire.enablewill default to enabling the WirePlumber session manager instead of pipewire-media-session. pipewire-media-session is deprecated by upstream and not recommended, but can still be manually enabled by settingservices.pipewire.media-session.enabletotrueandservices.pipewire.wireplumber.enabletofalse.pkgs.makeDesktopItemhas been refactored to provide a more idiomatic API. Specifically:All valid options as of FDO Desktop Entry specification version 1.4 can now be passed in as explicit arguments
execcan now be null, for entries that are not of type ApplicationmimeTypeargument is renamed tomimeTypesfor consistencymimeTypes,categories,implements,keywords,onlyShowInandnotShowIntake lists of strings instead of one string with semicolon separatorsextraDesktopEntriesrenamed toextraConfigfor consistencyActions should now be provided as an attrset
actions, theActionsline will be autogenerated.extraEntriesis removed.Additional validation is added both at eval time and at build time.
See the
vscodepackage for a more detailed example.Existing
resholve*functions have been renamed and nested underpkgs.resholve. Update uses to:resholvePackage->resholve.mkDerivationresholveScript->resholve.writeScriptresholveScriptBin->resholve.writeScriptBin
pkgs.cosmopolitanno longer provides thecosmoccommand. It has been moved topkgs.cosmoc.pkgs.graalvmXX-cepackages no longer provide support for Python/Ruby/WASM, instead focusing only in Java and Native Image Support. If you need to add support back, please see thepkgs.graalvmCEPackages.mkGraalfunction to create your own customized version of GraalVM with support for what you need.
Other Notable Changes
The option services.redis.servers was added to support per-application
redis-serverwhich is more secure since Redis databases are only mere key prefixes without any configuration or ACL of their own. Backward-compatibility is preserved by mapping oldservices.redis.settingstoservices.redis.servers."".settings, but you are strongly encouraged to name eachredis-serverinstance after the application using it, instead of keeping that nameless one. Except for the namelessservices.redis.servers.""still accessible at127.0.0.1:6379, and to the members of the Unix groupredisthrough the Unix socket/run/redis/redis.sock, all otherservices.redis.servers.${serverName}are only accessible by default to the members of the Unix groupredis-${serverName}through the Unix socket/run/redis-${serverName}/redis.sock.The option virtualisation.vmVariant was added to allow users to make changes to the
nixos-rebuild build-vmconfiguration that do not apply to their normal system.The
config.system.build.vmattribute now always exists and defaults to the value fromvmVariant. Configurations that import thevirtualisation/qemu-vm.nixmodule themselves will override this value, such thatvmVariantis not used.Similarly virtualisation.vmVariantWithBootloader was added.
The configuration portion of the
nix-daemonmodule has been reworked and exposed as nix.settings:Legacy options have been mapped to the corresponding options under nix.settings and will be deprecated when NixOS 21.11 reaches end of life.
nix.buildMachines.publicHostKey has been added.
kopsdefaults to 1.23.2, which will enable Instance Metadata Service Version 2 and require tokens on new clusters with Kubernetes >= 1.22. This will increase security by default, but may break some types of workloads. The default behaviour forspec.kubeDNS.nodeLocalDNS.forwardToKubeDNShas changed fromtruetofalse. Cilium now hasdisable-cnp-status-updates: trueby default. Set this to false if you rely on the CiliumNetworkPolicy status fields. Support for Kubernetes 1.17, the Lyft CNI, Weave CNI on Kubernetes >= 1.23, CentOS 7 and 8, Debian 9, RHEL 7, and Ubuntu 16.05 (Xenial) has been removed. See the 1.22 release notes and 1.23 release notes for more details, including other significant changes.Mattermost has been upgraded to extended support version 6.3 as the previously packaged extended support version 5.37 is reaching end of life. Migration may take some time, see the changelog and important upgrade notes.
The
writers.writePyPy2/writers.writePyPy3and correspondingwriters.writePyPy2Bin/writers.writePyPy3Binconvenience functions to create executable Python 2/3 scripts using the PyPy interpreter were added.Some improvements have been made to the
hadoopmodule:A
gatewayRoleoption has been added, for deploying hadoop cluster configuration files to a node that does not have any active servicesSupport for older versions of hadoop have been added to the module
Overriding and extending site XML files has been made easier
The auto-upgrade service now accepts persistent (default: true) parameter. By default auto-upgrade will now run immediately if it would have been triggered at least once during the time when the timer was inactive.
Mastodon now uses
services.redis.serversto start a new redis server, instead of using a global redis server. This improves compatibility with other services that use redis.Note that this will recreate the redis database, although according to the Mastodon docs, this is almost harmless:
Losing the Redis database is almost harmless: The only irrecoverable data will be the contents of the Sidekiq queues and scheduled retries of previously failed jobs. The home and list feeds are stored in Redis, but can be regenerated with tootctl.
If you do want to save the redis database, you can use the following commands:
redis-cli save cp /var/lib/redis/dump.rdb "/var/lib/redis-mastodon/dump.rdb"Peertube now uses services.redis.servers to start a new redis server, instead of using a global redis server. This improves compatibility with other services that use redis.
Redis database is used for storage only cache and job queue. More information can be found here - Peertube architecture.
If you do want to save the redis database, you can use the following commands before upgrade OS:
redis-cli save sudo mkdir /var/lib/redis-peertube sudo cp /var/lib/redis/dump.rdb /var/lib/redis-peertube/dump.rdbAdded the
keterNixOS module. Keter reverse proxies requests to your loaded application based on virtual hostnames.If you are using Wayland you can choose to use the Ozone Wayland support in Chrome and several Electron apps by setting the environment variable
NIXOS_OZONE_WL=1(for example viaenvironment.sessionVariables.NIXOS_OZONE_WL = "1"). This is not enabled by default because Ozone Wayland is still under heavy development and behavior is not always flawless. Furthermore, not all Electron apps use the latest Electron versions.A new option group
systemd.network.wait-onlinewas added, with options to configuresystemd-networkd-wait-online.service:anyInterfaceallows specifying that the network should be considered online when at least one interface is online (useful on laptops)timeoutdefines how long to wait for the network to come onlineextraArgsfor everything else
The
influxdb2package was split intoinfluxdb2-serverandinfluxdb2-cli, matching the split that took place upstream. A combinedinfluxdb2package is still provided in this release for backwards compatibility, but will be removed at a later date.The
unifipackage was switched fromunifi6tounifi7. Direct downgrades from Unifi 7 to Unifi 6 are not possible and require restoring from a backup made by Unifi 6.programs.zsh.autosuggestions.strategynow takes a list of strings instead of a string.The
asteriskandasterisk-stablepackages were switched fromasterisk_18to the newly-packagedasterisk_19. Asterisk 13 and 17 have been removed as they have reached their end of life.The
services.unifi.openPortsoption default value oftrueis now deprecated and will be changed tofalsein 22.11. Configurations using this default will print a warning when rebuilt.The
services.unifi-video.openPortsoption default value oftrueis now deprecated and will be changed tofalsein 22.11. Configurations using this default will print a warning when rebuilt.security.acmecertificates will now correctly check for CA revocation before reaching their minimum age.Removing domains from
security.acme.certs._name_.extraDomainNameswill now correctly remove those domains during rebuild/renew.MariaDB is now offered in several versions, not just the newest one. So if you have a need for running MariaDB 10.4 for example, you can now just set
services.mysql.package = pkgs.mariadb_104;. In general, it is recommended to run the newest version, to get the newest features, while sticking with an LTS version will most likely provide a more stable experience. Sometimes software is also incompatible with the newest version of MariaDB.The option programs.ssh.enableAskPassword was added, decoupling the setting of
SSH_ASKPASSfromservices.xserver.enable. This allows easy usage in non-X11 environments, e.g. Wayland.programs.ssh.knownHosts has gained an
extraHostNamesoption to augmenthostNames. It is now possible to use the attribute name of aknownHostsentry as the primary host name and specify secondary host names usingextraHostNameswithout having to duplicate the primary host name.The
services.stubbymodule was converted to a settings-style configuration.The option services.xserver.desktopManager.runXdgAutostartIfNone was added in order to automatically run XDG autostart files for sessions without a desktop manager. This replaces helpers like the
dexpackage.When setting i18n.inputMethod.enabled to
fcitx5, it no longer creates corresponding systemd user services. It now relies on XDG autostart files to start and work properly in your desktop sessions. If you are using only a window manager without a desktop manager, you need to enableservices.xserver.desktopManager.runXdgAutostartIfNoneor using thedexpackage to makefcitx5work.The option
services.duplicati.dataDirhas been added to allow changing the location of duplicati’s files.The options
boot.extraModprobeConfigandboot.blacklistedKernelModulesnow also take effect in the initrd by copying the file/etc/modprobe.d/nixos.confinto the initrd.nixos-generate-confignow puts the dhcp configuration inhardware-configuration.nixinstead ofconfiguration.nix.ORY Kratos was updated to version 0.9.0-alpha.3, which introduces some breaking changes:
All endpoints at the Admin API are now exposed at
/admin/. For example, endpointhttps://kratos:4434/identitiesis now exposed athttps://kratos:4434/admin/identitiesConfiguration key
selfservice.whitelisted_return_urlshas been renamed toallowed_return_urlsThe
password_identifierform field of the password login strategy has been renamed toidentifierto make compatibility with passwordless flows possible.Instead of having a global
default_schema_urlwhich developers used to update their schema, you now need to define thedefault_schema_idwhich must reference schema ID in your config.Calling
/self-service/recoverywithout flow ID or with an invalid flow ID while authenticated will now respond with an error instead of redirecting to the default page.If you are relying on the SQLite images, update your Docker Pull commands as follows:
docker pull oryd/kratos:{version}
Additionally, all passwords now have to be at least 8 characters long.
For more details, see:
fetchFromSourcehutnow allows fetching repositories recursively usingfetchgitorfetchhgif the argumentfetchSubmodulesis set totrue.A module for declarative configuration of openconnect VPN profiles was added under
networking.openconnect.The
element-desktoppackage now has anuseKeytaroption (defaults totrue), which allows disablingkeytarand in turnlibsecretusage (which binds to native credential managers / keychain libraries).The option
services.thelounge.pluginshas been added to allow installing plugins for The Lounge. Plugins can be found inpkgs.theLoungePlugins.pluginsandpkgs.theLoungePlugins.themes.The option
services.xserver.videoDriver = [ "nvidia" ];will now also install nvidia VA-API drivers by default.The
firmwareLinuxNonfreepackage has been renamed tolinux-firmware.It is now possible to specify wordlists to include as handy to access environment variables using the
config.environment.wordlistconfiguration options.The
services.mbpfanmodule was converted to a RFC 0042 configuration.The default value for
programs.spacefm.settings.graphical_sugot unset. It previously pointed togksuwhich has been removed.The Dino XMPP client was updated to 0.3, adding support for audio and video calls.
services.mattermost.pluginshas been added to allow the declarative installation of Mattermost plugins. Plugins are automatically repackaged using autoPatchelf.services.logrotate.enable now defaults to true if any rotate path has been defined, and some paths have been added by default.
The logrotate module also has been updated to freeform syntax:
services.logrotate.pathsandservices.logrotate.extraConfigwill work, but issue deprecation warnings and services.logrotate.settings should now be used instead.security.pam.usshhas been added, which allows authorizing PAM sessions based on SSH certificates held within an SSH agent, using pam-ussh.The
vscode-extensions.ionide.ionide-fsharppackage has been updated to 6.0.0 and now requires .NET 6.0.The
phpPackages.boxpackage has been updated from 2.7.5 to 3.16.0. See the upgrade guide for more details.The
zreplpackage has been updated from 0.4.0 to 0.5:The RPC protocol version was bumped; all zrepl daemons in a setup must be updated and restarted before replication can resume.
A bug involving encrypt-on-receive has been fixed. Read the zrepl documentation and check the output of
zfs get -r encryption,zrepl:placeholder PATH_TO_ROOTFSon the receiver.
The
polybarpackage has been updated from 3.5.7 to 3.6.2. See the changelog for more details.Breaking changes include changes to escaping rules in configuration values, changes in behavior when encountering invalid tag names, and changes to inter-process-messaging (IPC).
Renamed option
services.openssh.challengeResponseAuthenticationtoservices.openssh.kbdInteractiveAuthentication. Reason is that the old name has been deprecated upstream. Using the old option name will still work, but produce a warning.services.autorandrnow allows for adding hooks and profiles declaratively.The
pomerium-clicommand has been moved out of thepomeriumpackage into thepomerium-clipackage, following upstream’s repository split. If you are using thepomerium-clicommand, you should now install thepomerium-clipackage.The option
services.networking.networkmanager.enableFccUnlockwas added to support FCC unlock procedures. Since release 1.18.4, the ModemManager daemon no longer automatically performs the FCC unlock procedure by default. See the docs for more details.programs.tmuxhas a new optionpluginsthat accepts a list of packages from thetmuxPluginsgroup. The specified packages are added to the system and loaded bytmux.The polkit service, available at
security.polkit.enable, is now disabled by default. It will automatically be enabled through services and desktop environments as needed.mercurywas updated to 22.01.1, which has some breaking changes (Mercury 22.01 news).xfsprogs was update to version 5.15, which enables inobtcount and bigtime by default on filesystem creation. Support for these features was added in kernel 5.10 and deemed stable in kernel 5.15. If you want to be able to mount XFS filesystems created with this release of xfsprogs on kernel releases older than 5.10, you need to format them with
mkfs.xfs -m bigtime=0 -m inobtcount=0.services.xserver.desktopManager.xfcenow includes Xfce’s screen locker,xfce4-screensaverthat is enabled by default. You can disable it by settingfalseto services.xserver.desktopManager.xfce.enableScreensaver.The
hadooppackage has added support foraarch64-linuxandaarch64-darwinas of 3.3.1 (#158613).The
Rpackage now builds again onaarch64-darwin(#158992).The
nsspackage was split intonss_esrandnss_latest, withnssbeing an alias fornss_esr. This was done to ease maintenance ofnssand dependent high-profile packages likefirefox.The default
scribusversion is now 1.5, while version 1.4 is still available asscribus_1_4(#172700).The Nextcloud module now supports to create a Mysql database automatically with
services.nextcloud.database.createLocallyenabled.The Nextcloud module now allows setting the value of the
max-agedirective of theStrict-Transport-SecurityHTTP header, which is now controlled by theservices.nextcloud.httpsoption, rather thanservices.nginx.recommendedHttpHeaders.The
spark3package has been updated from 3.1.2 to 3.2.1 (#160075):The option
services.snapserver.openFirewallwill no longer default totruestarting with NixOS 22.11. Enable it explicitly if you need to control Snapserver remotely or connect streamig clients from other hosts.The option networking.useDHCP isn’t deprecated anymore. When using
systemd-networkd, a generic.network-unit is added which enables DHCP for each interface matchingen*,eth*orwl*with priority 99 (which means that it doesn’t have any effect if such an interface is matched by a.network-unit with a lower priority). In case of scripted networking, no behavior was changed.The new
postgresqlTestHookruns a PostgreSQL server for the duration of package checks.zfswas updated from 2.1.4 to 2.1.5, enabling it to be used with Linux kernel 5.18.stdenv.mkDerivationnow supports a self-referencingfinalAttrs:parameter containing the finalmkDerivationarguments including overrides.drv.overrideAttrsnow supports two parametersfinalAttrs: previousAttrs:. This allows packaging configuration to be overridden in a consistent manner by providing an alternative torec {}syntax.Additionally,
passthrucan now referencefinalAttrs.finalPackagecontaining the final package, including attributes such as the output paths andoverrideAttrs.New language integrations can be simplified by overriding a “prototype” package containing the language-specific logic. This removes the need for a extra layer of overriding for the “generic builder” arguments, thus removing a usability problem and source of error.
Release 21.11 (“Porcupine”, 2021/11/30)
Support is planned until the end of June 2022, handing over to 22.05.
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
Nix has been updated to version 2.4, reference its release notes for more information on what has changed. The previous version of Nix, 2.3.16, remains available for the time being in the
nix_2_3package.iptablesis now usingnf_tablesunder the hood, by usingiptables-nft, similar to Debian and Fedora. This means,ip[6]tables,arptablesandebtablescommands will actually show rules from some specific tables in thenf_tableskernel subsystem. In case you’re migrating from an older release without rebooting, there might be cases where you end up with iptable rules configured both in the legacyiptableskernel backend, as well as in thenf_tablesbackend. This can lead to confusing firewall behaviour. Aniptables-saveafter switching will complain about “iptables-legacy tables present”. It’s probably best to reboot after the upgrade, or manually removing all legacy iptables rules (via theiptables-legacypackage).systemd got an
nftablesbackend, and configures (networkd) rules in their ownio.systemd.*tables. Checknft list rulesetto see these rules, notiptables-save(which only showsiptables-created rules.PHP now defaults to PHP 8.0, updated from 7.4.
kops now defaults to 1.21.1, which uses containerd as the default runtime.
python3now defaults to Python 3.9, updated from Python 3.8.PostgreSQL now defaults to major version 13.
spark now defaults to spark 3, updated from 2. A migration guide is available.
Improvements have been made to the Hadoop module and package:
HDFS and YARN now support production-ready highly available deployments with automatic failover.
Hadoop now defaults to Hadoop 3, updated from 2.
JournalNode, ZKFS and HTTPFS services have been added.
Activation scripts can now, optionally, be run during a
nixos-rebuild dry-activateand can detect the dry activation by reading$NIXOS_ACTION. This allows activation scripts to output what they would change if the activation was really run. The users/modules activation script supports this and outputs some of is actions.KDE Plasma now finally works on Wayland.
bash now defaults to major version 5.
Systemd was updated to version 249 (from 247).
Pantheon desktop has been updated to version 6. Due to changes of screen locker, if locking doesn’t work for you, please try
gsettings set org.gnome.desktop.lockdown disable-lock-screen false.kubernetes-helmnow defaults to 3.7.0, which introduced some breaking changes to the experimental OCI manifest format. See HIP 6 for more details.helmfilealso defaults to 0.141.0, which is the minimum compatible version.GNOME has been upgraded to 41. Please take a look at their Release Notes for details.
LXD support was greatly improved:
building LXD images from configurations is now directly possible with just nixpkgs
hydra is now building nixOS LXD images that can be used standalone with full nixos-rebuild support
OpenSSH was updated to version 8.8p1
This breaks connections to old SSH daemons as ssh-rsa host keys and ssh-rsa public keys that were signed with SHA-1 are disabled by default now
These can be re-enabled, see the OpenSSH changelog for details
ORY Kratos was updated to version 0.8.0-alpha.3
This release requires you to run SQL migrations. Please, as always, create a backup of your database first!
The SDKs are now generated with tag v0alpha2 to reflect that some signatures have changed in a breaking fashion. Please update your imports from v0alpha1 to v0alpha2.
The SMTPS scheme used in courier config URL with cleartext/StartTLS/TLS SMTP connection types is now only supporting implicit TLS. For StartTLS and cleartext SMTP, please use the SMTP scheme instead.
for more details, see Release Notes.
New Services
btrbk, a backup tool for btrfs subvolumes, taking advantage of btrfs specific capabilities to create atomic snapshots and transfer them incrementally to your backup locations. Available as services.btrbk.
clipcat, an X11 clipboard manager written in Rust. Available at services.clipcat.
dex, an OpenID Connect (OIDC) identity and OAuth 2.0 provider. Available at services.dex.
geoipupdate, a GeoIP database updater from MaxMind. Available as services.geoipupdate.
Jibri, a service for recording or streaming a Jitsi Meet conference. Available as services.jibri.
Kea, ISCs 2nd generation DHCP and DDNS server suite. Available at services.kea.
owncast, self-hosted video live streaming solution. Available at services.owncast.
PeerTube, developed by Framasoft, is the free and decentralized alternative to video platforms. Available at services.peertube.
sourcehut, a collection of tools useful for software development. Available as services.sourcehut.
ucarp, an userspace implementation of the Common Address Redundancy Protocol (CARP). Available as networking.ucarp.
Users of flashrom should migrate to programs.flashrom.enable and add themselves to the
flashromgroup to be able to access programmers supported by flashrom.vikunja, a to-do list app. Available as services.vikunja.
opensnitch, an application firewall. Available as services.opensnitch.
snapraid, a backup program for disk arrays. Available as snapraid.
Hockeypuck, a OpenPGP Key Server. Available as services.hockeypuck.
buildkite-agent-metrics, a command-line tool for collecting Buildkite agent metrics, now has a Prometheus exporter available as services.prometheus.exporters.buildkite-agent.
influxdb-exporter a Prometheus exporter that exports metrics received on an InfluxDB compatible endpoint is now available as services.prometheus.exporters.influxdb.
mx-puppet-discord, a discord puppeting bridge for matrix. Available as
services.mx-puppet-discord.MeshCentral, a remote administration service (“TeamViewer but self-hosted and with more features”) is now available with a package and a module: services.meshcentral.enable
moonraker, an API web server for Klipper. Available as moonraker.
influxdb2, a Scalable datastore for metrics, events, and real-time analytics. Available as services.influxdb2.
isso, a commenting server similar to Disqus. Available as isso
navidrome, a personal music streaming server with subsonic-compatible api. Available as navidrome.
fluidd, a Klipper web interface for managing 3d printers using moonraker. Available as fluidd.
sx, a simple alternative to both xinit and startx for starting a Xorg server. Available as services.xserver.displayManager.sx
postfixadmin, a web based virtual user administration interface for Postfix mail servers.
prowlarr, an indexer manager/proxy built on the popular arr .net/reactjs base stack services.prowlarr.
soju, a user-friendly IRC bouncer. Available as services.soju.
nats, a high performance cloud and edge messaging system. Available as services.nats.
git, a distributed version control system. Available as programs.git.
parsedmarc, a service which parses incoming DMARC reports and stores or sends them to a downstream service for further analysis. Documented in its manual entry.
spark, a unified analytics engine for large-scale data processing.
touchegg, a multi-touch gesture recognizer. Available as services.touchegg.
pantheon-tweaks, an unofficial system settings panel for Pantheon. Available as
programs.pantheon-tweaks.joycond, a service that uses
hid-nintendoto provide nintendo joycond pairing and better nintendo switch pro controller support.multipath, the device mapper multipath (DM-MP) daemon. Available as services.multipath.
seafile, an open source file syncing & sharing software. Available as services.seafile.
rasdaemon, a hardware error logging daemon. Available as hardware.rasdaemon.
code-server-module now availablexmrig, a high performance, open source, cross platform RandomX, KawPow, CryptoNight and AstroBWT unified CPU/GPU miner and RandomX benchmark.
Auto nice daemons ananicy and ananicy-cpp. Available as services.ananicy.
smartctl_exporter, a Prometheus exporter for S.M.A.R.T. data. Available as services.prometheus.exporters.smartctl.
twingate, a high performance, easy to use zero trust solution that enables access to private resources from any device with better security than a VPN.
iio-niri, a utils that listens to
iio-sensor-proxyand updates Niri output orientation depending on the accelerometer orientation.
Backward Incompatibilities
The NixOS VM test framework,
pkgs.nixosTest/make-test-python.nix(pkgs.testers.nixosTestsince 22.05), now requires detaching commands such assucceed("foo &")andsucceed("foo | xclip -i")to close stdout. This can be done with a redirect such assucceed("foo >&2 &"). This breaking change was necessitated by a race condition causing tests to fail or hang. It applies to all methods that invoke commands on the nodes, includingexecute,succeed,fail,wait_until_succeeds,wait_until_fails.The
services.wakeonlanoption was removed, and replaced withnetworking.interfaces.<name>.wakeOnLan.The
security.wrappersoption now requires to always specify an owner, group and whether the setuid/setgid bit should be set. This is motivated by the fact that before NixOS 21.11, specifying either setuid or setgid but not owner/group resulted in wrappers owned by nobody/nogroup, which is unsafe.Since
iptablesnow usesnf_tablesbackend andipsetdoesn’t support it, some applications (ferm, shorewall, firehol) may have limited functionality.The
paperlessmodule and package have been removed. All users should migrate to the successorpaperless-nginstead. The Paperless project has been archived and advises all users to usepaperless-nginstead.Users can use the
services.paperless-ngmodule as a replacement while noting the following incompatibilities:services.paperless.ocrLanguageshas no replacement. Users should migrate toservices.paperless-ng.extraConfiginstead:
{ services.paperless-ng.extraConfig = { # Provide languages as ISO 639-2 codes # separated by a plus (+) sign. # https://en.wikipedia.org/wiki/List_of_ISO_639-2_codes PAPERLESS_OCR_LANGUAGE = "deu+eng+jpn"; # German & English & Japanese }; }If you previously specified
PAPERLESS_CONSUME_MAIL_*settings inservices.paperless.extraConfigyou should remove those options now. You now must define those settings in the admin interface of paperless-ng.Option
services.paperless.manageno longer exists. Use the script at${services.paperless-ng.dataDir}/paperless-ng-manageinstead. Note that this script only exists after thepaperless-ngservice has been started at least once.After switching to the new system configuration you should run the Django management command to reindex your documents and optionally create a user, if you don’t have one already.
To do so, enter the data directory (the value of
services.paperless-ng.dataDir,/var/lib/paperlessby default), switch to the paperless user and execute the management command like below:$ cd /var/lib/paperless $ su paperless -s /bin/sh $ ./paperless-ng-manage document_index reindex # if not already done create a user account, paperless-ng requires a login $ ./paperless-ng-manage createsuperuser Username (leave blank to use 'paperless'): my-user-name Email address: me@example.com Password: ********** Password (again): ********** Superuser created successfully.
The
staticjinjapackage has been upgraded from 1.0.4 to 4.1.1Firefox v91 does not support addons with invalid signature anymore. Firefox ESR needs to be used for nix addon support.
The
erigonethereum node has moved to a new database format in2021-05-04, and requires a full resyncThe
erigonethereum node has moved its database location in2021-08-03, users upgrading must manually move their chaindata (see release notes).users.users.<name>.group no longer defaults to
nogroup, which was insecure. Out-of-tree modules are likely to require adaptation: instead of{ users.users.foo = { isSystemUser = true; }; }also create a group for your user:
{ users.users.foo = { isSystemUser = true; group = "foo"; }; users.groups.foo = { }; }services.geoip-updaterwas broken and has been replaced by services.geoipupdate.ihatemoneyhas been updated to version 5.1.1 (release notes). If you serve ihatemoney by HTTP rather than HTTPS, you must set services.ihatemoney.secureCookie tofalse.PHP 7.3 is no longer supported due to upstream not supporting this version for the entire lifecycle of the 21.11 release.
Those making use of
buildBazelPackagewill need to regenerate the fetch hashes (preferred), or setfetchConfigured = false;.consulwas upgraded to a new major release with breaking changes, see upstream changelog.fsharp41 has been removed in preference to use the latest dotnet-sdk
The following F#-related packages have been removed for being unmaintaned. Please use
fetchNuGetfor specific packages.ExtCore
Fake
Fantomas
FsCheck
FsCheck262
FsCheckNunit
FSharpAutoComplete
FSharpCompilerCodeDom
FSharpCompilerService
FSharpCompilerTools
FSharpCore302
FSharpCore3125
FSharpCore4001
FSharpCore4117
FSharpData
FSharpData225
FSharpDataSQLProvider
FSharpFormatting
FsLexYacc
FsLexYacc706
FsLexYaccRuntime
FsPickler
FsUnit
Projekt
Suave
UnionArgParser
ExcelDnaRegistration
MathNetNumerics
programs.x2goserveris nowservices.x2goserverThe following dotnet-related packages have been removed for being unmaintaned. Please use
fetchNuGetfor specific packages.Autofac
SystemValueTuple
MicrosoftDiaSymReader
MicrosoftDiaSymReaderPortablePdb
SystemCollectionsImmutable
SystemCollectionsImmutable131
SystemReflectionMetadata
NUnit350
Deedle
ExcelDna
GitVersionTree
NDeskOptions
The
antlrpackage now defaults to the 4.x release instead of the old 2.7.7 version.The
pulseeffectspackage updated to version 4.x and renamed toeasyeffects.The
libwnckpackage now defaults to the 3.x release instead of the old 2.31.0 version.The
bitwarden_rspackages and modules were renamed tovaultwardenfollowing upstream. More specifically,pkgs.bitwarden_rs,pkgs.bitwarden_rs-sqlite,pkgs.bitwarden_rs-mysqlandpkgs.bitwarden_rs-postgresqlwere renamed topkgs.vaultwarden,pkgs.vaultwarden-sqlite,pkgs.vaultwarden-mysqlandpkgs.vaultwarden-postgresql, respectively.Old names are preserved as aliases for backwards compatibility, but may be removed in the future.
The
bitwarden_rsexecutable was also renamed tovaultwardenin all packages.
pkgs.bitwarden_rs-vaultwas renamed topkgs.vaultwarden-vault.pkgs.bitwarden_rs-vaultis preserved as an alias for backwards compatibility, but may be removed in the future.The static files were moved from
/usr/share/bitwarden_rsto/usr/share/vaultwarden.
The
services.bitwarden_rsconfig module was renamed toservices.vaultwarden.services.bitwarden_rsis preserved as an alias for backwards compatibility, but may be removed in the future.
systemd.services.bitwarden_rs,systemd.services.backup-bitwarden_rsandsystemd.timers.backup-bitwarden_rswere renamed tosystemd.services.vaultwarden,systemd.services.backup-vaultwardenandsystemd.timers.backup-vaultwarden, respectively.Old names are preserved as aliases for backwards compatibility, but may be removed in the future.
users.users.bitwarden_rsandusers.groups.bitwarden_rswere renamed tousers.users.vaultwardenandusers.groups.vaultwarden, respectively.The data directory remains located at
/var/lib/bitwarden_rs, for backwards compatibility.
yggdrasilwas upgraded to a new major release with breaking changes, see upstream changelog.icingaweb2was upgraded to a new release which requires a manual database upgrade, see upstream changelog.The
isabellepackage has been upgraded from 2020 to 2021the
mingw-64package has been upgraded from 6.0.0 to 9.0.0tt-rsswas upgraded to the commit on 2021-06-21, which has breaking changes. If you useservices.tt-rss.extraConfigyou should migrate to theputenv-style configuration. See this Discourse post in the tt-rss forums for more details.The following Visual Studio Code extensions were renamed to keep the naming convention uniform.
bbenoist.Nix->bbenoist.nixCoenraadS.bracket-pair-colorizer->coenraads.bracket-pair-colorizergolang.Go->golang.go
services.uptimednow uses/var/lib/uptimedas its stateDirectory instead of/var/spool/uptimed. Make sure to move all files to the new directory.Deprecated package aliases in
emacs.pkgs.*have been removed. These aliases were remnants of the old Emacs package infrastructure. We now use exact upstream names wherever possible.programs.neovim.runtimeswitched to alinkFarminternally, making it impossible to use wildcards in thesourceargument.The
openrazerandopenrazer-daemonpackages as well as thehardware.openrazermodule now require users to be members of theopenrazergroup instead ofplugdev. With this change, users no longer need be granted the entire set ofplugdevgroup permissions, which can include permissions other than those required byopenrazer. This is desirable from a security point of view. The settinghardware.openrazer.userscan be used to add users to theopenrazergroup.The fontconfig service’s dpi option has been removed. Fontconfig should use Xft settings by default so there’s no need to override one value in multiple places. The user can set DPI via ~/.Xresources properly, or at the system level per monitor, or as a last resort at the system level with
services.xserver.dpi.The
yambarpackage has been split intoyambarandyambar-wayland, corresponding to the xorg and wayland backend respectively. Please switch toyambar-waylandif you are on wayland.The
services.miniomodule gained an additional optionconsoleAddress, that configures the address and port the web UI is listening, it defaults to:9001. To be able to access the web UI this port needs to be opened in the firewall.The
varnishpackage was upgraded from 6.3.x to 7.x.varnish60for the last LTS release is also still available.The
kubernetespackage was upgraded to 1.22. Thekubernetes.apiserver.kubeletHttpsoption was removed and HTTPS is always used.The attribute
linuxPackages_latest_hardenedwas dropped because the hardened patches lag behind the upstream kernel which made version bumps harder. If you want to use a hardened kernel, please pin it explicitly with a versioned attribute such aslinuxPackages_5_10_hardened.The
nomadpackage now defaults to a 1.1.x release instead of 1.0.xIf
exfatis included inboot.supportedFilesystemsand when using kernel 5.7 or later, theexfatprogsuser-space utilities are used instead ofexfat.The
todomanpackage was upgraded from 3.9.0 to 4.0.0. This introduces breaking changes in the configuration file format.The
datadog-agent,datadog-integrations-coreanddatadog-process-agentpackages were upgraded from 6.11.2 to 7.30.2, git-2018-09-18 to 7.30.1 and 6.11.1 to 7.30.2, respectively. As a resultservices.datadog-agenthas had breaking changes to the configuration file. For details, see the upstream changelog.opencv2no longer includes the non-free libraries by default, and consequentlypfstoolsno longer includes OpenCV support by default. Both packages now support anenableUnfreeoption to re-enable this functionality.services.xserver.displayManager.defaultSession = "plasma5"does not work anymore, instead use either"plasma"for the Plasma X11 session or"plasmawayland"for the Plasma Wayland session.boot.kernelParamsnow only accepts one command line parameter per string. This change is aimed to reduce common mistakes like “param = 12”, which would be parsed as 3 parameters.nix.daemonNiceLevelandnix.daemonIONiceLevelhave been removed in favour of the new optionsnix.daemonCPUSchedPolicy,nix.daemonIOSchedClassandnix.daemonIOSchedPriority. Please refer to the options documentation and thesched(7)andioprio_set(2)man pages for guidance on how to use them.The
coursierpackage’s binary was renamed fromcoursiertocs. Completions which haven’t worked for a while should now work with the renamed binary. To keep usingcoursier, you can create a shell alias.The
services.mosquittomodule has been rewritten to support multiple listeners and per-listener configuration. Module configurations from previous releases will no longer work and must be updated.The
fluidsynth_1attribute has been removed, as this legacy version is no longer needed in nixpkgs. The actively maintained 2.x series is available asfluidsynthunchanged.Nextcloud 20 (
pkgs.nextcloud20) has been dropped because it was EOLed by upstream in 2021-10.The
virtualisation.pathsInNixDBoption was renamedvirtualisation.additionalPaths.The
services.ddclient.passwordoption was removed, and replaced withservices.ddclient.passwordFile.The default GNAT version has been changed: The
gnatattribute now points tognat12instead ofgnat9.retroArchCoreshas been removed. This means that usingnixpkgs.config.retroarchto customize RetroArch cores is not supported anymore. Instead, use package overrides, for example:retroarch.override { cores = with libretro; [ citra snes9x ]; };. Also,retroarchFullderivation is available for those who want to have all RetroArch cores available.The Linux kernel for security reasons now restricts access to BPF syscalls via
BPF_UNPRIV_DEFAULT_OFF=y. Unprivileged access can be re-enabled via thekernel.unprivileged_bpf_disabledsysctl knob./usrwill always be included in the initial ramdisk. See thefileSystems.<name>.neededForBootoption. If any files exist under/usr(which is not typical for NixOS), they will be included in the initial ramdisk, increasing its size to a possibly problematic extent.pkgs.haskell-language-serverwill now by default be linked dynamically to improve TemplateHaskell compatibility. To mitigate the increased closure size it will now by default only support our current default ghc (at the moment 9.0.2). Add other ghc versions via e.g.pkgs.haskell-language-server.override { supportedGhcVersions = [ "90" "92" ]; }.pkgs.redisis now built using the system jemalloc. This disables the experimental active defragmentation feature of redis. Users who require this feature can switch back to redis’ vendored version of jemalloc by settingservices.redis.package = pkgs.redis.override { useSystemJemalloc = false; };.
Other Notable Changes
The linux kernel package infrastructure was moved out of
all-packages.nix, and restructured. Linux related functions and attributes now live under thepkgs.linuxKernelattribute set. In particular the versionedlinuxPackages_*package sets (such aslinuxPackages_5_4) and kernels frompkgswere moved there and now live underpkgs.linuxKernel.packages.*. The unversioned ones (such aslinuxPackages_latest) remain untouched.In NixOS virtual machines (QEMU), the
virtualisationmodule has been updated with new options:forwardPortsto configure IPv4 port forwarding,sharedDirectoriesto set up shared host directories,resolutionto set the screen resolution,useNixStoreImageto use a disk image for the Nix store instead of 9P.
In addition, the default
msizeparameter in 9P filesystems (including /nix/store and all shared directories) has been increased to 16K for improved performance.The setting
services.openssh.logLevel"VERBOSE""INFO". This brings NixOS in line with upstream and other Linux distributions, and reduces log spam on servers due to bruteforcing botnets.However, if
services.fail2ban.enableistrue, thefail2banwill override the verbosity to"VERBOSE", so thatfail2bancan observe the failed login attempts from the SSH logs.The
services.xserver.extraLayoutsno longer cause additional rebuilds when a layout is added or modified.Sway: The terminal emulator
rxvt-unicodeis no longer installed by default viaprograms.sway.extraPackages. The current default configuration usesalacritty(and soonfoot) so this is only an issue when using a customized configuration and not installingrxvt-unicodeexplicitly.python3now defaults to Python 3.9. Python 3.9 introduces many deprecation warnings, please look at the What’s New In Python 3.9 post for more information.qtilehase been updated from ‘0.16.0’ to ‘0.18.0’, please check qtile changelog for changes.The
claws-mailpackage now references the new GTK+ 3 release branch, major version 4. To use the GTK+ 2 releases, one can install theclaws-mail-gtk2package.The wordpress module provides a new interface which allows to use different webservers with the new option
services.wordpress.webserver. Currentlyhttpd,caddyandnginxare supported. The definitions of wordpress sites should now be set inservices.wordpress.sites.Sites definitions that use the old interface are automatically migrated in the new option. This backward compatibility will be removed in 22.05.
The dokuwiki module provides a new interface which allows to use different webservers with the new option
services.dokuwiki.webserver. Currentlycaddyandnginxare supported. The definitions of dokuwiki sites should now be set inservices.dokuwiki.sites.Sites definitions that use the old interface are automatically migrated in the new option. This backward compatibility will be removed in 22.05.
The order of NSS (host) modules has been brought in line with upstream recommendations:
The
myhostnamemodule is placed before theresolve(optional) anddnsentries, but afterfile(to allow overriding via/etc/hosts/networking.extraHosts, and prevent ISPs with catchall-DNS resolvers from hijacking.localhostdomains)The
mymachinesmodule, which provides hostname resolution for local containers (registered withsystemd-machined) is placed to the front, to make sure its mappings are preferred over other resolvers.If systemd-networkd is enabled, the
resolvemodule is placed beforefilesandmyhostname, as it provides the same logic internally, with caching.The
mdns(_minimal)module has been updated to the new priorities.
If you use your own NSS host modules, make sure to update your priorities according to these rules:
NSS modules which should be queried before
resolvedDNS resolution should use mkBefore.NSS modules which should be queried after
resolved,filesandmyhostname, but beforednsshould use the default priorityNSS modules which should come after
dnsshould use mkAfter.
The networking.wireless module (based on wpa_supplicant) has been heavily reworked, solving a number of issues and adding useful features:
The automatic discovery of wireless interfaces at boot has been made reliable again (issues #101963, #23196).
WPA3 and Fast BSS Transition (802.11r) are now enabled by default for all networks.
Secrets like pre-shared keys and passwords can now be handled safely, meaning without including them in a world-readable file (
wpa_supplicant.confunder /nix/store). This is achieved by storing the secrets in a secured environmentFile and referring to them though environment variables that are expanded inside the configuration.With multiple interfaces declared, independent wpa_supplicant daemons are started, one for each interface (the services are named
wpa_supplicant-wlan0,wpa_supplicant-wlan1, etc.).The generated
wpa_supplicant.conffile is now formatted for easier reading.A new scanOnLowSignal option has been added to facilitate fast roaming between access points (enabled by default).
A new networks.<name>.authProtocols option has been added to change the authentication protocols used when connecting to a network.
The networking.wireless.iwd module has a new networking.wireless.iwd.settings option.
The services.smokeping.host option was added and defaulted to
localhost. Before,smokepinglistened to all interfaces by default. NixOS defaults generally aim to provide non-Internet-exposed defaults for databases and internal monitoring tools, see e.g. #100192. Further, the systemd service forsmokepinggot reworked defaults for increased operational stability, see PR #144127 for details.The services.syncoid.enable module now properly drops ZFS permissions after usage. Before it delegated permissions to whole pools instead of datasets and didn’t clean up after execution. You can manually look this up for your pools by running
zfs allow your-pool-nameand usezfs unallow syncoid your-pool-nameto clean this up.Zfs:
latestCompatibleLinuxPackagesis now exported on the zfs package. One can useboot.kernelPackages = config.boot.zfs.package.latestCompatibleLinuxPackages;to always track the latest compatible kernel with a given version of zfs.Nginx will use the value of
sslTrustedCertificateif provided for a virtual host, even ifenableACMEis set. This is useful for providers not using the same certificate to sign OCSP responses and server certificates.lib.formats.yaml’sgeneratewill not generate JSON anymore, but instead use more of the YAML-specific syntax.MariaDB was upgraded from 10.5.x to 10.6.x. Please read the upstream release notes for changes and upgrade instructions.
The MariaDB C client library, also known as libmysqlclient or mariadb-connector-c, was upgraded from 3.1.x to 3.2.x. While this should hopefully not have any impact, this upgrade comes with some changes to default behavior, so you might want to review the upstream release notes.
GNOME desktop environment now enables
QGnomePlatformas the Qt platform theme, which should avoid crashes when opening file chooser dialogs in Qt apps by using XDG desktop portal. Additionally, it will make the apps fit better visually.rofihas been updated from ‘1.6.1’ to ‘1.7.0’, one important thing is the removal of the old xresources based configuration setup. Read more in rofi’s changelog.ipfs now defaults to not listening on you local network. This setting was change as server providers won’t accept port scanning on their private network. If you have several ipfs instances running on a network you own, feel free to change the setting
ipfs.localDiscovery = true;. localDiscovery enables different instances to discover each other and share data.luaandluajitinterpreters have been patched to avoid looking into /usr/lib directories, thus increasing the purity of the build.Three new options, xdg.mime.addedAssociations, xdg.mime.defaultApplications, and xdg.mime.removedAssociations have been added to the xdg.mime module to allow the configuration of
/etc/xdg/mimeapps.list.Kopia was upgraded from 0.8.x to 0.9.x. Please read the upstream release notes for changes and upgrade instructions.
The
systemd.networkmodule has gained support for the FooOverUDP link type.The
networkingmodule has a newnetworking.fooOverUDPoption to configure Foo-over-UDP encapsulations.networking.sitsnow supports Foo-over-UDP encapsulation.The
virtualisation.libvirtdmodule has been refactored and updated with new options:virtualisation.libvirtd.qemu*options (e.g.:virtualisation.libvirtd.qemuRunAsRoot) were moved tovirtualisation.libvirtd.qemusubmodule,software TPM1/TPM2 support (e.g.: Windows 11 guests) (
virtualisation.libvirtd.qemu.swtpm),custom OVMF package (e.g.:
pkgs.OVMFFullwith HTTP, CSM and Secure Boot support) (virtualisation.libvirtd.qemu.ovmf.package).
The
cawbirdTwitter client now uses its own API keys to count as different application than upstream builds. This is done to evade application-level rate limiting. While existing accounts continue to work, users may want to remove and re-register their account in the client to enjoy a better user experience and benefit from this change.A new option
services.prometheus.enableReloadhas been added which can be enabled to reload the prometheus service when its config file changes instead of restarting.The option
services.prometheus.environmentFilehas been removed since it was causing issues and Prometheus now has native support for secret files, i.e.basic_auth.password_fileandauthorization.credentials_file.Dokuwiki now supports caddy! However
the nginx option has been removed, in the new configuration, please use the
dokuwiki.webserver = "nginx"instead.The “${hostname}” option has been deprecated, please use
dokuwiki.sites = [ "${hostname}" ]instead
The services.unifi module has been reworked, solving a number of issues. This leads to several user facing changes:
The
services.unifi.dataDiroption is removed and the data is now always located under/var/lib/unifi/data. This is done to make better use of systemd state direcotiry and thus making the service restart more reliable.The unifi logs can now be found under:
/var/log/unifiinstead of/var/lib/unifi/logs.The unifi run directory can now be found under:
/run/unifiinstead of/var/lib/unifi/run.
security.pam.services.<name>.makeHomeDirnow usesumask=0077instead ofumask=0022when creating the home directory.Loki has had another release. Some default values have been changed for the configuration and some configuration options have been renamed. For more details, please check the upgrade guide.
julianow refers tojulia-stableinstead ofjulia-lts. In practice this means it has been upgraded from1.0.4to1.5.4.RetroArch has been upgraded from version
1.8.5to1.9.13.2. Since the previous release was quite old, if you’re having issues after the upgrade, please delete your$XDG_CONFIG_HOME/retroarch/retroarch.cfgfile.hydrus has been upgraded from version
438to463. Since upgrading between releases this old is advised against, be sure to have a backup of your data before upgrading. For details, see the hydrus manual.More jdk and jre versions are now exposed via
java-packages.compiler.The sets
haskell.packagesandhaskell.compilernow contain for every ghc version an attribute with the minor version dropped. E.g. forghc8107there also now existsghc810. Those attributes point to the same compilers and packagesets but have the advantage that e.g.ghc92stays stable when we update fromghc925toghc926.
Release 21.05 (“Okapi”, 2021.05/31)
Support is planned until the end of December 2021, handing over to 21.11.
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
Core version changes:
gcc: 9.3.0 -> 10.3.0
glibc: 2.30 -> 2.32
default linux: 5.4 -> 5.10, all supported kernels available
mesa: 20.1.7 -> 21.0.1
Desktop Environments:
GNOME: 3.36 -> 40, see its release notes
Plasma5: 5.18.5 -> 5.21.3
kdeApplications: 20.08.1 -> 20.12.3
cinnamon: 4.6 -> 4.8.1
Programming Languages and Frameworks:
Python optimizations were disabled again. Builds with optimizations enabled are not reproducible. Optimizations can now be enabled with an option.
The linux_latest kernel was updated to the 5.13 series. It currently is not officially supported for use with the zfs filesystem. If you use zfs, you should use a different kernel version (either the LTS kernel, or track a specific one).
New Services
The following new services were added since the last release:
GNURadio 3.8 and 3.9 were finally packaged, along with a rewrite to the Nix expressions, allowing users to override the features upstream supports selecting to compile or not to. Additionally, the attribute
gnuradio(3.9),gnuradio3_8andgnuradio3_7now point to an externally wrapped by default derivations, that allow you to also add `extraPythonPackages` to the Python interpreter used by GNURadio. Missing environmental variables needed for operational GUI were also added (#75478).Keycloak, an open source identity and access management server with support for OpenID Connect, OAUTH 2.0 and SAML 2.0.
See the Keycloak section of the NixOS manual for more information.
services.samba-wsdd.enable Web Services Dynamic Discovery host daemon
Discourse, a modern and open source discussion platform.
See the Discourse section of the NixOS manual for more information.
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
GNOME desktop environment was upgraded to 40, see the release notes for 40.0 and 3.38. The
gnome3attribute set has been renamed tognomeand so have been the NixOS options.If you are using
services.udev.extraRulesto assign custom names to network interfaces, this may stop working due to a change in the initialisation of dhcpcd and systemd networkd. To avoid this, either move them toservices.udev.initrdRulesor see the new Assigning custom names section of the NixOS manual for an example using networkd links.The
security.hideProcessInformationmodule has been removed. It was broken since the switch to cgroups-v2.The
linuxPackages.ati_drivers_x11kernel modules have been removed. The drivers only supported kernels prior to 4.2, and thus have become obsolete.The
systemConfigkernel parameter is no longer added to boot loader entries. It has been unused since September 2010, but if do have a system generation from that era, you will now be unable to boot into them.systemd-journal2gelfno longer parses json and expects the receiving system to handle it. How to achieve this with Graylog is described in this GitHub issue.If the
services.dbusmodule is enabled, then the user D-Bus session is now always socket activated. The associated optionsservices.dbus.socketActivatedandservices.xserver.startDbusSessionhave therefore been removed and you will receive a warning if they are present in your configuration. This change makes the user D-Bus session available also for non-graphical logins.The
networking.wireless.iwdmodule now installs the upstream-provided 80-iwd.link file, which sets the NamePolicy= for all wlan devices to “keep kernel”, to avoid race conditions between iwd and networkd. If you don’t want this, you can setsystemd.network.links."80-iwd" = lib.mkForce {}.rubyMinimalwas removed due to being unused and unusable. The default ruby interpreter includes JIT support, which makes it reference it’s compiler. Since JIT support is probably needed by some Gems, it was decided to enable this feature with all cc references by default, and allow to build a Ruby derivation without references to cc, by settingjitSupport = false;in an overlay. See #90151 for more info.Setting
services.openssh.authorizedKeysFilesnow also affects which keyssecurity.pam.enableSSHAgentAuthwill use. WARNING: If you are using these options in combination do make sure that any key paths you use are present inservices.openssh.authorizedKeysFiles!The option
fonts.enableFontDirhas been renamed to fonts.fontDir.enable. The path of font directory has also been changed to/run/current-system/sw/share/X11/fonts, for consistency with other X11 resources.A number of options have been renamed in the kicad interface.
oceSupporthas been renamed towithOCE,withOCCThas been renamed towithOCC,ngspiceSupporthas been renamed towithNgspice, andscriptingSupporthas been renamed towithScripting. Additionally,kicad/base.nixno longer provides default argument values since these are provided bykicad/default.nix.The socket for the
pdns-recursormodule was moved from/var/lib/pdns-recursorto/run/pdns-recursorto match upstream.Paperwork was updated to version 2. The on-disk format slightly changed, and it is not possible to downgrade from Paperwork 2 back to Paperwork 1.3. Back your documents up before upgrading. See this thread for more details.
PowerDNS has been updated from
4.2.xto4.3.x. Please be sure to review the Upgrade Notes provided by upstream before upgrading. Worth specifically noting is that the service now runs entirely as a dedicatedpdnsuser, instead of starting asrootand dropping privileges, as well as the defaultsocket-dirlocation changing from/var/lib/powerdnsto/run/pdns.The
mediatombservice is now using by default the new and maintained forkgerberapackage instead of the unmaintainedmediatombpackage. If you want to keep the old behavior, you must declare it with:{ services.mediatomb.package = pkgs.mediatomb; }One new option
openFirewallhas been introduced which defaults to false. If you relied on the service declaration to add the firewall rules itself before, you should now declare it with:{ services.mediatomb.openFirewall = true; }xfsprogs was update from 4.19 to 5.11. It now enables reflink support by default on filesystem creation. Support for reflinks was added with an experimental status to kernel 4.9 and deemed stable in kernel 4.16. If you want to be able to mount XFS filesystems created with this release of xfsprogs on kernel releases older than those, you need to format them with
mkfs.xfs -m reflink=0.The uWSGI server is now built with POSIX capabilities. As a consequence, root is no longer required in emperor mode and the service defaults to running as the unprivileged
uwsgiuser. Any additional capability can be added via the new option services.uwsgi.capabilities. The previous behaviour can be restored by setting:{ services.uwsgi.user = "root"; services.uwsgi.group = "root"; services.uwsgi.instance = { uid = "uwsgi"; gid = "uwsgi"; }; }Another incompatibility from the previous release is that vassals running under a different user or group need to use
immediate-{uid,gid}instead of the usualuid,gidoptions.btc1 has been abandoned upstream, and removed.
cpp_ethereum (aleth) has been abandoned upstream, and removed.
riak-cs package removed along with
services.riak-csmodule.stanchion package removed along with
services.stanchionmodule.mutt has been updated to a new major version (2.x), which comes with some backward incompatible changes that are described in the release notes for Mutt 2.0.
vimandneovimswitched to Python 3, dropping all Python 2 support.networking.wireguard.interfaces.<name>.generatePrivateKeyFile, which is off by default, had a
chmodrace condition fixed. As an aside, the parent directory’s permissions were widened, and the key files were made owner-writable. This only affects newly created keys. However, if the exact permissions are important for your setup, read #121294.boot.zfs.forceImportAll previously did nothing, but has been fixed. However its default has been changed to
falseto preserve the existing default behaviour. If you have this explicitly set totrue, please note that your non-root pools will now be forcibly imported.openafs now points to openafs_1_8, which is the new stable release. OpenAFS 1.6 was removed.
The WireGuard module gained a new option
networking.wireguard.interfaces.<name>.peers.*.dynamicEndpointRefreshSecondsthat implements refreshing the IP of DNS-based endpoints periodically (which WireGuard itself cannot do).MariaDB has been updated to 10.5. Before you upgrade, it would be best to take a backup of your database and read Incompatible Changes Between 10.4 and 10.5. After the upgrade you will need to run
mysql_upgrade.The TokuDB storage engine dropped in mariadb 10.5 and removed in mariadb 10.6. It is recommended to switch to RocksDB. See also TokuDB and MDEV-19780: Remove the TokuDB storage engine.
The
openldapmodule now has support for OLC-style configuration, users of theconfigDiroption may wish to migrate. If you continue to useconfigDir, ensure thatolcPidFileis set to/run/slapd/slapd.pid.As a result,
extraConfigandextraDatabaseConfigare removed. To help with migration, you can convert yourslapd.conffile to OLC configuration with the following script (find the location of this configuration file by runningsystemctl status openldap, it is the-foption.$ TMPDIR=$(mktemp -d) $ slaptest -f /path/to/slapd.conf -F $TMPDIR $ slapcat -F $TMPDIR -n0 -H 'ldap:///???(!(objectClass=olcSchemaConfig))'This will dump your current configuration in LDIF format, which should be straightforward to convert into Nix settings. This does not show your schema configuration, as this is unnecessarily verbose for users of the default schemas and
slaptestis buggy with schemas directly in the config file.Amazon EC2 and OpenStack Compute (nova) images now re-fetch instance meta data and user data from the instance metadata service (IMDS) on each boot. For example: stopping an EC2 instance, changing its user data, and restarting the instance will now cause it to fetch and apply the new user data.
Warning
Specifically,
/etc/ec2-metadatais re-populated on each boot. Some NixOS scripts that read from this directory are guarded to only run if the files they want to manipulate do not already exist, and so will not re-apply their changes if the IMDS response changes. Examples:root’s SSH key is only added if/root/.ssh/authorized_keysdoes not exist, and SSH host keys are only set from user data if they do not exist in/etc/ssh.The
rspamdservices is now sandboxed. It is run as a dynamic user instead of root, so secrets and other files may have to be moved or their permissions may have to be fixed. The sockets are now located in/run/rspamdinstead of/run.Enabling the Tor client no longer silently also enables and configures Privoxy, and the
services.tor.client.privoxy.enableoption has been removed. To enable Privoxy, and to configure it to use Tor’s faster port, use the following configuration:{ opt-services.privoxy.enable = true; opt-services.privoxy.enableTor = true; }The
services.tormodule has a new exhaustively typed services.tor.settings option following RFC 0042; backward compatibility with old options has been preserved when aliasing was possible. The corresponding systemd service has been hardened, but there is a chance that the service still requires more permissions, so please report any related trouble on the bugtracker. Onion services v3 are now supported in services.tor.relay.onionServices. A new services.tor.openFirewall option as been introduced for allowing connections on all the TCP ports configured.The options
services.slurm.dbdserver.storagePassandservices.slurm.dbdserver.configFilehave been removed. Useservices.slurm.dbdserver.storagePassFileinstead to provide the database password. Extra config options can be given via the optionservices.slurm.dbdserver.extraConfig. The actual configuration file is created on the fly on startup of the service. This avoids that the password gets exposed in the nix store.The
wafHookhook does not wrap Python anymore. Packages depending onwafHookneed to include any Python into theirnativeBuildInputs.Starting with version 1.7.0, the project formerly named
CodiMDis now namedHedgeDoc. New installations will no longer use the old name for users, state directories and such, this needs to be considered when moving state to a more recent NixOS installation. Based on system.stateVersion, existing installations will continue to work.The fish-foreign-env package has been replaced with fishPlugins.foreign-env, in which the fish functions have been relocated to the
vendor_functions.ddirectory to be loaded automatically.The prometheus json exporter is now managed by the prometheus community. Together with additional features some backwards incompatibilities were introduced. Most importantly the exporter no longer accepts a fixed command-line parameter to specify the URL of the endpoint serving JSON. It now expects this URL to be passed as an URL parameter, when scraping the exporter’s
/probeendpoint. In the prometheus scrape configuration the scrape target might look like this:http://some.json-exporter.host:7979/probe?target=https://example.com/some/json/endpointExisting configuration for the exporter needs to be updated, but can partially be re-used. Documentation is available in the upstream repository and a small example for NixOS is available in the corresponding NixOS test.
These changes also affect services.prometheus.exporters.rspamd.enable, which is just a preconfigured instance of the json exporter.
For more information, take a look at the official documentation of the json_exporter.
Androidenv was updated, removing the
includeDocsandlldbVersionsarguments. Docs only covered a single version of the Android SDK, LLDB is now bundled with the NDK, and both are no longer available to download from the Android package repositories. Additionally, since the package lists have been updated, some older versions of Android packages may not be bundled. If you depend on older versions of Android packages, we recommend overriding the repo.Android packages are now loaded from a repo.json file created by parsing Android repo XML files. The arguments
repoJsonandrepoXmlshave been added to allow overriding the built-in androidenv repo.json with your own. Additionally, license files are now written to allow compatibility with Gradle-based tools, and theextraLicensesargument has been added to accept more SDK licenses if your project requires it. See the androidenv documentation for more details.The attribute
mpiis now consistently used to provide a default, system-wide MPI implementation. The default implementation is openmpi, which has been used before by all derivations affects by this change. Note that all packages that have usedmpi ? nullin the input for optional MPI builds, have been changed to the boolean input parameteruseMpito enable building with MPI. Building all packages withmpichinstead of the defaultopenmpican now be achieved like this:self: super: { mpi = super.mpich; }The Searx module has been updated with the ability to configure the service declaratively and uWSGI integration. The option
services.searx.configFilehas been renamed to services.searx.settingsFile for consistency with the new services.searx.settings. In addition, thesearxuid and gid reservations have been removed since they were not necessary: the service is now running with a dynamically allocated uid.The libinput module has been updated with the ability to configure mouse and touchpad settings separately. The options in
services.xserver.libinputhave been renamed toservices.xserver.libinput.touchpad, while there is a newservices.xserver.libinput.mousefor mouse related configuration.Since touchpad options no longer apply to all devices, you may want to replicate your touchpad configuration in mouse section.
ALSA OSS emulation (
sound.enableOSSEmulation) is now disabled by default.Thinkfan as been updated to
1.2.x, which comes with a new YAML based configuration format. For this reason, several NixOS options of the thinkfan module have been changed to non-backward compatible types. In addition, a new services.thinkfan.settings option has been added.Please read the thinkfan documentation before updating.
Adobe Flash Player support has been dropped from the tree. In particular, the following packages no longer support it:
chromium
firefox
qt48
qt5.qtwebkit
Additionally, packages flashplayer and hal-flash were removed along with the
services.flashpolicydmodule.The
security.rngdmodule has been removed. It was disabled by default in 20.09 as it was functionally redundant with krngd in the linux kernel. It is not necessary for any device that the kernel recognises as an hardware RNG, as it will automatically run the krngd task to periodically collect random data from the device and mix it into the kernel’s RNG.The default SMTP port for GitLab has been changed to
25from its previous default of465. If you depended on this default, you should now set the services.gitlab.smtp.port option.The default version of ImageMagick has been updated from 6 to 7. You can use imagemagick6, imagemagick6_light, and imagemagick6Big if you need the older version.
services.xserver.videoDrivers no longer uses the deprecated
cirrusandvesadevice dependent X drivers by default. It also enables bothamdgpuandnouveaudrivers by default now.The
kindlegenpackage is gone, because it is no longer supported or hosted by Amazon. Sadly, its replacement, Kindle Previewer, has no Linux support. However, there are other ways to generate MOBI files. See the discussion for more info.The apacheKafka packages are now built with version-matched JREs. Versions 2.6 and above, the ones that recommend it, use jdk11, while versions below remain on jdk8. The NixOS service has been adjusted to start the service using the same version as the package, adjustable with the new services.apache-kafka.jre option. Furthermore, the default list of services.apache-kafka.jvmOptions have been removed. You should set your own according to the upstream documentation for your Kafka version.
The kodi package has been modified to allow concise addon management. Consider the following configuration from previous releases of NixOS to install kodi, including the kodiPackages.inputstream-adaptive and kodiPackages.vfs-sftp addons:
{ environment.systemPackages = [ pkgs.kodi ]; nixpkgs.config.kodi = { enableInputStreamAdaptive = true; enableVFSSFTP = true; }; }All Kodi
configflags have been removed, and as a result the above configuration should now be written as:{ environment.systemPackages = [ (pkgs.kodi.withPackages ( p: with p; [ inputstream-adaptive vfs-sftp ] )) ]; }environment.defaultPackagesnow includes the nano package. If pkgs.nano is not added to the list, make sure another editor is installed and theEDITORenvironment variable is set to it. Environment variables can be set usingenvironment.variables.services.minio.dataDirchanged type to a list of paths, required for specifying multiple data directories for using with erasure coding. Currently, the service doesn’t enforce nor checks the correct number of paths to correspond to minio requirements.All CUDA toolkit versions prior to CUDA 10 have been removed.
The kbdKeymaps package was removed since dvp and neo are now included in kbd. If you want to use the Programmer Dvorak Keyboard Layout, you have to use
dvorak-programmerinconsole.keyMapnow instead ofdvp. Inservices.xserver.xkbVariantit’s stilldvp.The babeld service is now being run as an unprivileged user. To achieve that the module configures
skip-kernel-setup trueand takes care of setting forwarding and rp_filter sysctls by itself as well as for each interface inservices.babeld.interfaces.The
services.zigbee2mqtt.configoption has been renamed toservices.zigbee2mqtt.settingsand now follows RFC 0042.
The yadm dotfile manager has been updated from 2.x to 3.x, which has new (XDG) default locations for some data/state files. Most yadm commands will fail and print a legacy path warning (which describes how to upgrade/migrate your repository). If you have scripts, daemons, scheduled jobs, shell profiles, etc. that invoke yadm, expect them to fail or misbehave until you perform this migration and prepare accordingly.
Instead of determining
services.radicale.packageautomatically based onsystem.stateVersion, the latest version is always used because old versions are not officially supported.Furthermore, Radicale’s systemd unit was hardened which might break some deployments. In particular, a non-default
filesystem_folderhas to be added tosystemd.services.radicale.serviceConfig.ReadWritePathsif the deprecatedservices.radicale.configis used.In the
security.acmemodule, use of--reuse-keyparameter for Lego has been removed. It was introduced for HKPK, but this security feature is now deprecated. It is a better security practice to rotate key pairs instead of always keeping the same. If you need to keep this parameter, you can add it back usingextraLegoRenewFlagsas an option for the appropriate certificate.
Other Notable Changes
stdenv.libhas been deprecated and will break eval in 21.11. Please usepkgs.libinstead. See #108938 for details.GNURadio has a
pkgsattribute set, and there’s agnuradio.callPackagefunction that extendspkgswith amkDerivation, and amkDerivationWith, like Qt5. Now allgnuradio.pkgsare defined withgnuradio.callPackageand some packages that depend on gnuradio are defined with this as well.Privoxy has been updated to version 3.0.32 (See announcement). Compared to the previous release, Privoxy has gained support for HTTPS inspection (still experimental), Brotli decompression, several new filters and lots of bug fixes, including security ones. In addition, the package is now built with compression and external filters support, which were previously disabled.
Regarding the NixOS module, new options for HTTPS inspection have been added and
services.privoxy.extraConfighas been replaced by the new services.privoxy.settings (See RFC 0042 for the motivation).Kodi has been updated to version 19.1 “Matrix”. See the announcement for further details.
The
services.packagekit.backendoption has been removed as it only supported a single setting which would always be the default. Instead new RFC 0042 compliant services.packagekit.settings and services.packagekit.vendorSettings options have been introduced.Nginx has been updated to stable version 1.20.0. Now nginx uses the zlib-ng library by default.
KDE Gear (formerly KDE Applications) is upgraded to 21.04, see its release notes for details.
The
kdeApplicationspackage set is nowkdeGear, in keeping with the new name. The old name remains for compatibility, but it is deprecated.Libreswan has been updated to version 4.4. The package now includes example configurations and manual pages by default. The NixOS module has been changed to use the upstream systemd units and write the configuration in the
/etc/ipsec.d/directory. In addition, two new options have been added to specify connection policies (services.libreswan.policies) and disable send/receive redirects (services.libreswan.disableRedirects).The Mailman NixOS module (
services.mailman) has a new option services.mailman.enablePostfix, defaulting to true, that controls integration with Postfix.If this option is disabled, default MTA config becomes not set and you should set the options in
services.mailman.settings.mtaaccording to the desired configuration as described in Mailman documentation.The default-version of
nextcloudis nextcloud21. Please note that it’s not possible to upgradenextcloudacross multiple major versions! This means that it’s e.g. not possible to upgrade from nextcloud18 to nextcloud20 in a single deploy and most20.09users will have to upgrade to nextcloud20 first.The package can be manually upgraded by setting services.nextcloud.package to nextcloud21.
The setting services.redis.bind defaults to
127.0.0.1now, making Redis listen on the loopback interface only, and not all public network interfaces.NixOS now emits a deprecation warning if systemd’s
StartLimitIntervalsetting is used in aserviceConfigsection instead of in aunitConfig; that setting is deprecated and now undocumented for the service section by systemd upstream, but still effective and somewhat buggy there, which can be confusing. See #45785 for details.All services should use systemd.services.name.startLimitIntervalSec or
StartLimitIntervalSecin systemd.services.name.unitConfig instead.The
mediatombservice declares new options. It also adapts existing options so the configuration generation is now lazy. The existing optioncustomCfg(defaults to false), when enabled, stops the service configuration generation completely. It then expects the users to provide their own correct configuration at the right location (whereas the configuration was generated and not used at all before). The new optiontranscodingOption(defaults to no) allows a generated configuration. It makes the mediatomb service pulls the necessary runtime dependencies in the nix store (whereas it was generated with hardcoded values before). The new optionmediaDirectoriesallows the users to declare autoscan media directories from their nixos configuration:{ services.mediatomb.mediaDirectories = [ { path = "/var/lib/mediatomb/pictures"; recursive = false; hidden-files = false; } { path = "/var/lib/mediatomb/audio"; recursive = true; hidden-files = false; } ]; }The Unbound DNS resolver service (
services.unbound) has been refactored to allow reloading, control sockets and to fix startup ordering issues.It is now possible to enable a local UNIX control socket for unbound by setting the services.unbound.localControlSocketPath option.
Previously we just applied a very minimal set of restrictions and trusted unbound to properly drop root privs and capabilities.
As of this we are (for the most part) just using the upstream example unit file for unbound. The main difference is that we start unbound as
unbounduser with the required capabilities instead of letting unbound do the chroot & uid/gid changes.The upstream unit configuration this is based on is a lot stricter with all kinds of permissions then our previous variant. It also came with the default of having the
Typeset tonotify, therefore we are now also using theunbound-with-systemdpackage here. Unbound will start up, read the configuration files and start listening on the configured ports before systemd will declare the unitactive (running). This will likely help with startup order and the occasional race condition during system activation where the DNS service is started but not yet ready to answer queries. Services depending onnss-lookup.targetorunbound.serviceare now be able to use unbound when those targets have been reached.Additionally to the much stricter runtime environment the
/dev/urandommount lines we previously had in the code (that randomly failed during the stop-phase) have been removed as systemd will take care of those for us.The
preStartscript is now only required if we enabled the trust anchor updates (which are still enabled by default).Another benefit of the refactoring is that we can now issue reloads via either
pkill -HUP unboundandsystemctl reload unboundto reload the running configuration without taking the daemon offline. A prerequisite of this was that unbound configuration is available on a well known path on the file system. We are using the path/etc/unbound/unbound.confas that is the default in the CLI tooling which in turn enables us to useunbound-controlwithout passing a custom configuration location.The module has also been reworked to be RFC 0042 compliant. As such,
services.unbound.extraConfighas been removed and replaced by services.unbound.settings.services.unbound.interfaceshas been renamed toservices.unbound.settings.server.interface.services.unbound.forwardAddressesandservices.unbound.allowedAccesshave also been changed to use the new settings interface. You can follow the instructions when executingnixos-rebuildto upgrade your configuration to use the new interface.The
services.dnscrypt-proxy2module now takes the upstream’s example configuration and updates it with the user’s settings. An option has been added to restore the old behaviour if you prefer to declare the configuration from scratch.NixOS now defaults to the unified cgroup hierarchy (cgroupsv2). See the Fedora Article for 31 for details on why this is desirable, and how it impacts containers.
If you want to run containers with a runtime that does not yet support cgroupsv2, you can switch back to the old behaviour by setting systemd.enableUnifiedCgroupHierarchy =
false; and rebooting.PulseAudio was upgraded to 14.0, with changes to the handling of default sinks. See its release notes.
GNOME users may wish to delete their
~/.config/pulsedue to the changes to stream routing logic. See PulseAudio bug 832 for more information.The zookeeper package does not provide
zooInspector.shanymore, as that “contrib” has been dropped from upstream releases.In the ACME module, the data used to build the hash for the account directory has changed to accommodate new features to reduce account rate limit issues. This will trigger new account creation on the first rebuild following this update. No issues are expected to arise from this, thanks to the new account creation handling.
users.users.name.createHome now always ensures home directory permissions to be
0700. Permissions had previously been ignored for already existing home directories, possibly leaving them readable by others. The option’s description was incorrect regarding ownership management and has been simplified greatly.When defining a new user, one of users.users.name.isNormalUser and users.users.name.isSystemUser is now required. This is to prevent accidentally giving a UID above 1000 to system users, which could have unexpected consequences, like running user activation scripts for system users. Note that users defined with an explicit UID below 500 are exempted from this check, as users.users.name.isSystemUser has no effect for those.
The
security.apparmormodule, for the AppArmor Mandatory Access Control system, has been substantially improved along with related tools, so that module maintainers can now more easily write AppArmor profiles for NixOS. The most notable change on the user-side is the new option security.apparmor.policies, replacing the previousprofilesoption to provide a way to disable a profile and to select whether to confine in enforce mode (default) or in complain mode (seejournalctl -b --grep apparmor). Security-minded users may also want to enable security.apparmor.killUnconfinedConfinables, at the cost of having some of their processes killed when updating to a NixOS version introducing new AppArmor profiles.The GNOME desktop manager once again installs gnome.epiphany by default.
NixOS now generates empty
/etc/netgroup./etc/netgroupdefines network-wide groups and may affect to setups using NIS.Platforms, like
stdenv.hostPlatform, no longer have aplatformattribute. It has been (mostly) flattened away:platform.gccis nowgccplatform.kernel*is nowlinux-kernel.*
Additionally,
platform.kernelArchmoved to the top level aslinuxArchto match the other*Archvariables.The
platformgrouping of these things never meant anything, and was just a historical/implementation artifact that was overdue removal.services.resticnow uses a dedicated cache directory for every backup defined inservices.restic.backups. The old global cache directory,/root/.cache/restic, is now unused and can be removed to free up disk space.isync: Theisynccompatibility wrapper was removed and the Master/Slave terminology has been deprecated and should be replaced with Far/Near in the configuration file.The nix-gc service now accepts randomizedDelaySec (default: 0) and persistent (default: true) parameters. By default nix-gc will now run immediately if it would have been triggered at least once during the time when the timer was inactive.
The
rustPlatform.buildRustPackagefunction is split into several hooks: cargoSetupHook to set up vendoring for Cargo-based projects, cargoBuildHook to build a project using Cargo, cargoInstallHook to install a project using Cargo, and cargoCheckHook to run tests in Cargo-based projects. With this change, mixed-language projects can use the relevant hooks within builders other thanbuildRustPackage. However, these changes also required several API changes tobuildRustPackageitself:The
targetargument was removed. Instead,buildRustPackagewill always use the same target as the C/C++ compiler that is used.The
cargoParallelTestThreadsargument was removed. Parallel tests are now disabled throughdontUseCargoParallelTests.
The
rustPlatform.maturinBuildHookhook was added. This hook can be used withbuildPythonPackageto build Python packages that are written in Rust and use Maturin as their build tool.Kubernetes has deprecated docker as container runtime. As a consequence, the Kubernetes module now has support for configuration of custom remote container runtimes and enables containerd by default. Note that containerd is more strict regarding container image OCI-compliance. As an example, images with CMD or ENTRYPOINT defined as strings (not lists) will fail on containerd, while working fine on docker. Please test your setup and container images with containerd prior to upgrading.
The GitLab module now has support for automatic backups. A schedule can be set with the services.gitlab.backup.startAt option.
Prior to this release, systemd would also read system units from an undocumented
/etc/systemd-mutable/systempath. This path has been dropped from the defaults. That path (or others) can be re-enabled by adding it to the boot.extraSystemdUnitPaths list.PostgreSQL 9.5 is scheduled EOL during the 21.05 life cycle and has been removed.
Xfce4 relies on GIO/GVfs for userspace virtual filesystem access in applications like thunar and gigolo. For that to work, the gvfs nixos service is enabled by default, and it can be configured with the specific package that provides GVfs. Until now Xfce4 was setting it to use a lighter version of GVfs (without support for samba). To avoid conflicts with other desktop environments this setting has been dropped. Users that still want it should add the following to their system configuration:
{ services.gvfs.package = pkgs.gvfs.override { samba = null; }; }The newly enabled
systemd-pstore.servicenow automatically evacuates crashdumps and panic logs from the persistent storage to/var/lib/systemd/pstore. This prevents NVRAM from filling up, which ensures the latest diagnostic data is always stored and alleviates problems with writing new boot configurations.Nixpkgs now contains automatically packaged GNOME Shell extensions from the GNOME Extensions portal. You can find them, filed by their UUID, under
gnome38Extensionsattribute for GNOME 3.38 and undergnome40Extensionsfor GNOME 40. Finally, thegnomeExtensionsattribute contains extensions for the latest GNOME Shell version in Nixpkgs, listed under a more human-friendly name. The unqualified attribute scope also contains manually packaged extensions. Note that the automatically packaged extensions are provided for convenience and are not checked or guaranteed to work.Erlang/OTP versions older than R21 got dropped. We also dropped the cuter package, as it was purely an example of how to build a package. We also dropped
lfe_1_2as it could not build with R21+. Moving forward, we expect to only support 3 yearly releases of OTP.
Release 20.09 (“Nightingale”, 2020.10/27)
Support is planned until the end of June 2021, handing over to 21.05. (Plans have shifted by two months since release of 20.09.)
Highlights
In addition to 7349 new, 14442 updated, and 8181 removed packages, this release has the following highlights:
Core version changes:
gcc: 9.2.0 -> 9.3.0
glibc: 2.30 -> 2.31
linux: still defaults to 5.4.x, all supported kernels available
mesa: 19.3.5 -> 20.1.7
Desktop Environments:
plasma5: 5.17.5 -> 5.18.5
kdeApplications: 19.12.3 -> 20.08.1
gnome3: 3.34 -> 3.36, see its release notes
cinnamon: added at 4.6
NixOS now distributes an official GNOME ISO
Programming Languages and Frameworks:
Agda ecosystem was heavily reworked (see more details below)
PHP now defaults to PHP 7.4, updated from 7.3
PHP 7.2 is no longer supported due to upstream not supporting this version for the entire lifecycle of the 20.09 release
Python 3 now defaults to Python 3.8 instead of 3.7
Python 3.5 reached its upstream EOL at the end of September 2020: it has been removed from the list of available packages
Databases and Service Monitoring:
MariaDB has been updated to 10.4, MariaDB Galera to 26.4. Please read the related upgrade instructions under backwards incompatibilities before upgrading.
Zabbix now defaults to 5.0, updated from 4.4. Please read related sections under backwards compatibilities before upgrading.
Major module changes:
Quickly configure a complete, private, self-hosted video conferencing solution with the new Jitsi Meet module.
Two new options, authorizedKeysCommand and authorizedKeysCommandUser, have been added to the
opensshmodule. If you haveAuthorizedKeysCommandin your services.openssh.extraConfig you should make use of these new options instead.There is a new module for Podman (
virtualisation.podman), a drop-in replacement for the Docker command line.The new
virtualisation.containersmodule manages configuration shared by the CRI-O and Podman modules.Declarative Docker containers are renamed from
docker-containerstovirtualisation.oci-containers.containers. This is to make it possible to usepodmaninstead ofdocker.The new option documentation.man.generateCaches has been added to automatically generate the
man-dbcaches, which are needed by utilities likewhatisandapropos. The caches are generated during the build of the NixOS configuration: since this can be expensive when a large number of packages are installed, the feature is disabled by default.services.postfix.sslCACertwas replaced byservices.postfix.tlsTrustedAuthoritieswhich now defaults to system certificate authorities.The various documented workarounds to use steam have been converted to a module.
programs.steam.enableenables steam, controller support and the workarounds.Support for built-in LCDs in various pieces of Logitech hardware (keyboards and USB speakers).
hardware.logitech.lcd.enableenables support for all hardware supported by the g15daemon project.The GRUB module gained support for basic password protection, which allows to restrict non-default entries in the boot menu to one or more users. The users and passwords are defined via the option
boot.loader.grub.users. Note: Password support is only available in GRUB version 2.
NixOS module changes:
The NixOS module system now supports freeform modules as a mix between
types.attrsOfandtypes.submodule. These allow you to explicitly declare a subset of options while still permitting definitions without an associated option. See the section called “Freeform modules” for how to use them.Following its deprecation in 20.03, the Perl NixOS test driver has been removed. All remaining tests have been ported to the Python test framework. Code outside nixpkgs using
make-test.nixortesting.nixneeds to be ported tomake-test-python.nixandtesting-python.nixrespectively.Subordinate GID and UID mappings are now set up automatically for all normal users. This will make container tools like Podman work as non-root users out of the box.
Starting with this release, the hydra-build-result
nixos-YY.MMbranches no longer exist in the deprecated nixpkgs-channels repository. These branches are now in the main nixpkgs repository.
New Services
In addition to 1119 new, 118 updated, and 476 removed options; 61 new modules were added since the last release:
Hardware:
hardware.system76.firmware-daemon.enable adds easy support of system76 firmware
hardware.uinput.enable loads uinput kernel module
hardware.video.hidpi.enable enable good defaults for HiDPI displays
hardware.wooting.enable support for Wooting keyboards
hardware.xpadneo.enable xpadneo driver for Xbox One wireless controllers
Programs:
programs.hamster.enable enable hamster time tracking
programs.steam.enable adds easy enablement of steam and related system configuration
Security:
security.doas.enable alternative to sudo, allows non-root users to execute commands as root
security.tpm2.enable add Trusted Platform Module 2 support
System:
boot.initrd.network.openvpn.enable start an OpenVPN client during initrd boot
Virtualization:
boot.enableContainers use nixos-containers
virtualisation.oci-containers.containers run OCI (Docker) containers
virtualisation.podman.enable daemonless container engine
Services:
services.ankisyncd.enableAnki sync serverservices.bazarr.enable Subtitle manager for Sonarr and Radarr
services.biboumi.enable Biboumi XMPP gateway to IRC
services.blockbook-frontend Blockbook-frontend, a service for the Trezor wallet
services.cage.enable Wayland cage service
services.convos.enable IRC daemon, which can be accessed through the browser
services.engelsystem.enable Tool for coordinating volunteers and shifts on large events
services.espanso.enable text-expander written in rust
services.foldingathome.enable Folding@home client
services.gerrit.enable Web-based team code collaboration tool
services.go-neb.enable Matrix bot
services.hardware.xow.enable xow as a systemd service
services.hercules-ci-agent.enable Hercules CI build agent
services.jicofo.enable Jitsi Conference Focus, component of Jitsi Meet
services.jirafeau.enable A web file repository
services.jitsi-meet.enable Secure, simple and scalable video conferences
services.jitsi-videobridge.enable Jitsi Videobridge, a WebRTC compatible router
services.jupyterhub.enable Jupyterhub development server
services.k3s.enable Lightweight Kubernetes distribution
services.magic-wormhole-mailbox-server.enable Magic Wormhole Mailbox Server
services.malcontent.enable Parental Control support
services.matrix-appservice-discord.enable Matrix and Discord bridge
services.mautrix-telegram.enable Matrix-Telegram puppeting/relaybot bridge
services.mirakurun.enable Japanese DTV Tuner Server Service
services.molly-brown.enable Molly-Brown Gemini server
services.mullvad-vpn.enable Mullvad VPN daemon
services.ncdns.enable Namecoin to DNS bridge
services.nextdns.enable NextDNS to DoH Proxy service
services.nix-store-gcs-proxy Google storage bucket to be used as a nix store
services.onedrive.enable OneDrive sync service
services.pinnwand.enable Pastebin-like service
services.pixiecore.enable Manage network booting of machines
services.privacyidea.enable Privacy authentication server
services.quorum.enable Quorum blockchain daemon
services.robustirc-bridge.enable RobustIRC bridge
services.rss-bridge.enable Generate RSS and Atom feeds
services.rtorrent.enable rTorrent service
services.smartdns.enable SmartDNS DNS server
services.sogo.enable SOGo groupware
services.teeworlds.enable Teeworlds game server
services.torque.mom.enable torque computing node
services.torque.server.enable torque server
services.tuptime.enable A total uptime service
services.urserver.enable X11 remote server
services.wasabibackend.enable Wasabi backend service
services.yubikey-agent.enable Yubikey agent
services.zigbee2mqtt.enable Zigbee to MQTT bridge
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
MariaDB has been updated to 10.4, MariaDB Galera to 26.4. Before you upgrade, it would be best to take a backup of your database. For MariaDB Galera Cluster, see Upgrading from MariaDB 10.3 to MariaDB 10.4 with Galera Cluster instead. Before doing the upgrade read Incompatible Changes Between 10.3 and 10.4. After the upgrade you will need to run
mysql_upgrade. MariaDB 10.4 introduces a number of changes to the authentication process, intended to make things easier and more intuitive. See Authentication from MariaDB 10.4. unix_socket auth plugin does not use a password, and uses the connecting user’s UID instead. When a new MariaDB data directory is initialized, two MariaDB users are created and can be used with new unix_socket auth plugin, as well as traditional mysql_native_password plugin: root@localhost and mysql@localhost. To actually use the traditional mysql_native_password plugin method, one must run the following:{ services.mysql.initialScript = pkgs.writeText "mariadb-init.sql" '' ALTER USER root@localhost IDENTIFIED VIA mysql_native_password USING PASSWORD("verysecret"); ''; }When MariaDB data directory is just upgraded (not initialized), the users are not created or modified.
MySQL server is now started with additional systemd sandbox/hardening options for better security. The PrivateTmp, ProtectHome, and ProtectSystem options may be problematic when MySQL is attempting to read from or write to your filesystem anywhere outside of its own state directory, for example when calling
LOAD DATA INFILE or SELECT * INTO OUTFILE. In this scenario a variant of the following may be required: - allow MySQL to read from /home and /tmp directories when usingLOAD DATA INFILE{ systemd.services.mysql.serviceConfig.ProtectHome = lib.mkForce "read-only"; }- allow MySQL to write to custom folder
/var/datawhen usingSELECT * INTO OUTFILE, assuming the mysql user has write access to/var/data{ systemd.services.mysql.serviceConfig.ReadWritePaths = [ "/var/data" ]; }The MySQL service no longer runs its
systemdservice startup script asrootanymore. A dedicated nonrootsuper user account is required for operation. This means users with an existing MySQL or MariaDB database server are required to run the following SQL statements as a super admin user before upgrading:CREATE USER IF NOT EXISTS 'mysql'@'localhost' identified with unix_socket; GRANT ALL PRIVILEGES ON *.* TO 'mysql'@'localhost' WITH GRANT OPTION;If you use MySQL instead of MariaDB please replace
unix_socketwithauth_socket. If you have changed the value of services.mysql.user from the default ofmysqlto a different user please change'mysql'@'localhost'to the corresponding user instead.Zabbix now defaults to 5.0, updated from 4.4. Please carefully read through the upgrade guide and apply any changes required. Be sure to take special note of the section on enabling extended range of numeric (float) values as you will need to apply this database migration manually.
If you are using Zabbix Server with a MySQL or MariaDB database you should note that using a character set of
utf8and a collate ofutf8_binhas become mandatory with this release. See the upstream issue for further discussion. Before upgrading you should check the character set and collation used by your database and ensure they are correct:SELECT default_character_set_name, default_collation_name FROM information_schema.schemata WHERE schema_name = 'zabbix';If these values are not correct you should take a backup of your database and convert the character set and collation as required. Here is an example of how to do so, taken from the Zabbix forums:
ALTER DATABASE `zabbix` DEFAULT CHARACTER SET utf8 COLLATE utf8_bin; -- the following will produce a list of SQL commands you should subsequently execute SELECT CONCAT("ALTER TABLE ", TABLE_NAME," CONVERT TO CHARACTER SET utf8 COLLATE utf8_bin;") AS ExecuteTheString FROM information_schema.`COLUMNS` WHERE table_schema = "zabbix" AND COLLATION_NAME = "utf8_general_ci";maxx package removed along with
services.xserver.desktopManager.maxxmodule. Please migrate to cdesktopenv andservices.xserver.desktopManager.cdemodule.The matrix-synapse module no longer includes optional dependencies by default, they have to be added through the plugins option.
buildGoModulenow internally creates a vendor directory in the source tree for downloaded modules instead of using go’s module proxy protocol. This storage format is simpler and therefore less likely to break with future versions of go. As a resultbuildGoModuleswitched frommodSha256to thevendorSha256attribute to pin fetched version data.Grafana is now built without support for phantomjs by default. Phantomjs support has been deprecated in Grafana and the phantomjs project is currently unmaintained. It can still be enabled by providing
phantomJsSupport = trueto the package instantiation:{ services.grafana.package = pkgs.grafana.overrideAttrs (oldAttrs: rec { phantomJsSupport = true; }); }The supybot module now uses
/var/lib/supybotas its default stateDir path ifstateVersionis 20.09 or higher. It also enables a number of systemd sandboxing options which may possibly interfere with some plugins. If this is the case you can disable the options through attributes insystemd.services.supybot.serviceConfig.The
security.duosec.skeyoption, which stored a secret in the nix store, has been replaced by a new security.duosec.secretKeyFile option for better security.security.duosec.ikeyhas been renamed to security.duosec.integrationKey.vmwarehas been removed from theservices.x11.videoDriversdefaults. For VMWare guests setvirtualisation.vmware.guest.enabletotruewhich will include the appropriate drivers.The initrd SSH support now uses OpenSSH rather than Dropbear to allow the use of Ed25519 keys and other OpenSSH-specific functionality. Host keys must now be in the OpenSSH format, and at least one pre-generated key must be specified.
If you used the
boot.initrd.network.ssh.host*Keyoptions, you’ll get an error explaining how to convert your host keys and migrate to the newboot.initrd.network.ssh.hostKeysoption. Otherwise, if you don’t have any host keys set, you’ll need to generate some; see thehostKeysoption documentation for instructions.Since this release there’s an easy way to customize your PHP install to get a much smaller base PHP with only wanted extensions enabled. See the following snippet installing a smaller PHP with the extensions
imagick,opcache,pdoandpdo_mysqlloaded:{ environment.systemPackages = [ (pkgs.php.withExtensions ( { all, ... }: with all; [ imagick opcache pdo pdo_mysql ] )) ]; }The default
phpattribute hasn’t lost any extensions. Theopcacheextension has been added. All upstream PHP extensions are available under php.extensions.<name?>.All PHP
configflags have been removed for the following reasons:The updated
phpattribute is now easily customizable to your liking by usingphp.withExtensionsorphp.buildEnvinstead of writing config files or changing configure flags.The remaining configuration flags can now be set directly on the
phpattribute. For example, instead ofphp.override { config.php.embed = true; config.php.apxs2 = false; }you should now write
php.override { embedSupport = true; apxs2Support = false; }The ACME module has been overhauled for simplicity and maintainability. Cert generation now implicitly uses the
acmeuser, and thesecurity.acme.certs._name_.useroption has been removed. Instead, certificate access from other services is now managed through group permissions. The module no longer runs lego twice under certain conditions, and will correctly renew certificates if their configuration is changed. Services which reload nginx and httpd after certificate renewal are now properly configured too so you no longer have to do this manually if you are using HTTPS enabled virtual hosts. A mechanism for regenerating certs on demand has also been added and documented.Gollum received a major update to version 5.x and you may have to change some links in your wiki when migrating from gollum 4.x. More information can be found here.
Deluge 2.x was added and is used as default for new NixOS installations where stateVersion is >= 20.09. If you are upgrading from a previous NixOS version, you can set
service.deluge.package = pkgs.deluge-2_xto upgrade to Deluge 2.x and migrate the state to the new format. Be aware that backwards state migrations are not supported by Deluge.Nginx web server now starting with additional sandbox/hardening options. By default, write access to
/var/log/nginxand/var/cache/nginxis allowed. To allow writing to other folders, usesystemd.services.nginx.serviceConfig.ReadWritePaths{ systemd.services.nginx.serviceConfig.ReadWritePaths = [ "/var/www" ]; }Nginx is also started with the systemd option
ProtectHome = mkDefault true;which forbids it to read anything from/home,/rootand/run/user(see ProtectHome docs for details). If you require serving files from home directories, you may choose to set e.g.{ systemd.services.nginx.serviceConfig.ProtectHome = "read-only"; }The NixOS options
nesting.cloneandnesting.childrenhave been deleted, and replaced with named specialisation configurations.Replace a
nesting.cloneentry with:{ specialisation.example-sub-configuration = { configuration = { # ... }; }; }Replace a
nesting.childrenentry with:{ specialisation.example-sub-configuration = { inheritParentConfig = false; configuration = { # ... }; }; }To switch to a specialised configuration at runtime you need to run:
$ sudo /run/current-system/specialisation/example-sub-configuration/bin/switch-to-configuration testBefore you would have used:
$ sudo /run/current-system/fine-tune/child-1/bin/switch-to-configuration testThe Nginx log directory has been moved to
/var/log/nginx, the cache directory to/var/cache/nginx. The optionservices.nginx.stateDirhas been removed.The httpd web server previously started its main process as root privileged, then ran worker processes as a less privileged identity user. This was changed to start all of httpd as a less privileged user (defined by services.httpd.user and services.httpd.group). As a consequence, all files that are needed for httpd to run (included configuration fragments, SSL certificates and keys, etc.) must now be readable by this less privileged user/group.
The default value for services.httpd.mpm has been changed from
preforktoevent. Along with this change the default value for services.httpd.virtualHosts.<name>.http2 has been set totrue.The
systemd-networkdoptionsystemd.network.networks.<name>.dhcp.CriticalConnectionhas been removed following upstream systemd’s deprecation of the same. It is recommended to usesystemd.network.networks.<name>.networkConfig.KeepConfigurationinstead. See systemd.network 5 for details.The
systemd-networkdoptionsystemd.network.networks._name_.dhcpConfighas been renamed to systemd.network.networks.name.dhcpV4Config following upstream systemd’s documentation change. See systemd.network 5 for details.In the
picommodule, several options that accepted floating point numbers encoded as strings (for example services.picom.activeOpacity) have been changed to the (relatively) new nativefloattype. To migrate your configuration remove the quotes around the numbers.When using
buildBazelPackagefrom Nixpkgs,flathash mode is now used for dependencies instead ofrecursive. This is to better allow using hashed mirrors where needed. As a result, these hashes will have changed.The syntax of the PostgreSQL configuration file is now checked at build time. If your configuration includes a file inaccessible inside the build sandbox, set
services.postgresql.checkConfigtofalse.The rkt module has been removed, it was archived by upstream.
The Bazaar VCS is unmaintained and, as consequence of the Python 2 EOL, the packages
bazaarandbazaarToolswere removed. Breezy, the backward compatible fork of Bazaar (see the announcement), was packaged asbreezyand can be used instead.Regarding Nixpkgs,
fetchbzr,nix-prefetch-bzrand Bazaar support in Hydra will continue to work through Breezy.In addition to the hostname, the fully qualified domain name (FQDN), which consists of
${networking.hostName}and${networking.domain}is now added to/etc/hosts, to allow local FQDN resolution, as used by thehostname --fqdncommand and other applications that try to determine the FQDN. These new entries take precedence over entries from the DNS which could cause regressions in some very specific setups. Additionally the hostname is now resolved to127.0.0.2instead of127.0.1.1to be consistent with whatnss-myhostname(from systemd) returns. The old behaviour can e.g. be restored by usingnetworking.hosts = lib.mkForce { "127.0.1.1" = [ config.networking.hostName ]; };.The hostname (
networking.hostName) must now be a valid DNS label (see RFC 1035, RFC 1123) and as such must not contain the domain part. This means that the hostname must start with a letter or digit, end with a letter or digit, and have as interior characters only letters, digits, and hyphen. The maximum length is 63 characters. Additionally it is recommended to only use lower-case characters. If (e.g. for legacy reasons) a FQDN is required as the Linux kernel network node hostname (uname --nodename) the optionboot.kernel.sysctl."kernel.hostname"can be used as a workaround (but be aware of the 64 character limit).The GRUB specific option
boot.loader.grub.extraInitrdhas been replaced with the generic optionboot.initrd.secrets. This option creates a secondary initrd from the specified files, rather than using a manually created initrd file. Due to an existing bug withboot.loader.grub.extraInitrd, it is not possible to directly boot an older generation that used that option. It is still possible to rollback to that generation if the required initrd file has not been deleted.The DNSChain package and NixOS module have been removed from Nixpkgs as the software is unmaintained and can’t be built. For more information see issue #89205.
In the
resiliomodule, services.resilio.httpListenAddr has been changed to listen to[::1]instead of0.0.0.0.sslhhas been updated to version1.21. Thesslprobe must be renamed totlsin services.sslh.appendConfig.Users of OpenAFS 1.6 must upgrade their services to OpenAFS 1.8! In this release, the OpenAFS package version 1.6.24 is marked broken but can be used during transition to OpenAFS 1.8.x. Use the options
services.openafsClient.packages.module,services.openafsClient.packages.programsandservices.openafsServer.packageto select a different OpenAFS package. OpenAFS 1.6 will be removed in the next release. The packageopenafsand the service options will then silently point to the OpenAFS 1.8 release.See also the OpenAFS Administrator Guide for instructions. Beware of the following when updating servers:
The storage format of the server key has changed and the key must be converted before running the new release.
When updating multiple database servers, turn off the database servers from the highest IP down to the lowest with resting periods in between. Start up in reverse order. Do not concurrently run database servers working with different OpenAFS releases!
Update servers first, then clients.
Radicale’s default package has changed from 2.x to 3.x. An upgrade checklist can be found here. You can use the newer version in the NixOS service by setting the
packagetoradicale3, which is done automatically ifstateVersionis 20.09 or higher.udptexperienced a complete rewrite from C++ to rust. The configuration format changed from ini to toml. The new configuration documentation can be found at the official website and example configuration is packaged in${udpt}/share/udpt/udpt.toml.We now have a unified services.xserver.displayManager.autoLogin option interface to be used for every display-manager in NixOS.
The
bitcoindmodule has changed to multi-instance, using submodules. Therefore, it is now mandatory to name each instance. To use this new multi-instance config with an existing bitcoind data directory and user, you have to adjust the original config, e.g.:{ services.bitcoind = { enable = true; extraConfig = "..."; # ... }; }To something similar:
{ services.bitcoind.mainnet = { enable = true; dataDir = "/var/lib/bitcoind"; user = "bitcoin"; extraConfig = "..."; # ... }; }The key settings are:
dataDir- to continue using the same data directory.user- to continue using the same user so that bitcoind maintains access to its files.
Graylog introduced a change in the LDAP server certificate validation behaviour for version 3.3.3 which might break existing setups. When updating Graylog from a version before 3.3.3 make sure to check the Graylog release info for information on how to avoid the issue.
The
dokuwikimodule has changed to multi-instance, using submodules. Therefore, it is now mandatory to name each instance. Moreover, forcing SSL by default has been dropped, songinx.forceSSLandnginx.enableACMEare no longer set totrue. To continue using your service with the original SSL settings, you have to adjust the original config, e.g.:{ services.dokuwiki = { enable = true; # ... }; }To something similar:
{ services.dokuwiki."mywiki" = { enable = true; nginx = { forceSSL = true; enableACME = true; }; # ... }; }The base package has also been upgraded to the 2020-07-29 “Hogfather” release. Plugins might be incompatible or require upgrading.
The services.postgresql.dataDir option is now set to
"/var/lib/postgresql/${cfg.package.psqlSchema}"regardless of your system.stateVersion. Users with an existing postgresql install that have a system.stateVersion of17.03or below should double check what the value of their services.postgresql.dataDir option is (/var/db/postgresql) and then explicitly set this value to maintain compatibility:{ services.postgresql.dataDir = "/var/db/postgresql"; }The postgresql module now expects there to be a database super user account called
postgresregardless of your system.stateVersion. Users with an existing postgresql install that have a system.stateVersion of17.03or below should run the following SQL statements as a database super admin user before upgrading:CREATE ROLE postgres LOGIN SUPERUSER;The USBGuard module now removes options and instead hardcodes values for
IPCAccessControlFiles,ruleFiles, andauditFilePath. Audit logs can be found in the journal.The NixOS module system now evaluates option definitions more strictly, allowing it to detect a larger set of problems. As a result, what previously evaluated may not do so anymore. See the PR that changed this for more info.
For NixOS configuration options, the type
loaOf, after its initial deprecation in release 20.03, has been removed. In NixOS and Nixpkgs options using this type have been converted toattrsOf. For more information on this change have look at these links: issue #1800, PR #63103.config.systemd.services.${name}.pathnow returns a list of paths instead of a colon-separated string.Caddy module now uses Caddy v2 by default. Caddy v1 can still be used by setting services.caddy.package to
pkgs.caddy1.New option services.caddy.adapter has been added.
The jellyfin module will use and stay on the Jellyfin version
10.5.5ifstateVersionis lower than20.09. This is because significant changes were made to the database schema, and it is highly recommended to backup your instance before upgrading. After making your backup, you can upgrade to the latest version either by setting yourstateVersionto20.09or higher, or set theservices.jellyfin.packagetopkgs.jellyfin. If you do not wish to upgrade Jellyfin, but want to change yourstateVersion, you can set the value ofservices.jellyfin.packagetopkgs.jellyfin_10_5.The
security.rngdservice is now disabled by default. This choice was made because there’s krngd in the linux kernel space making it (for most usecases) functionally redundant.The
hardware.nvidia.optimus_prime.enableservice has been renamed tohardware.nvidia.prime.sync.enableand has many new enhancements. Related nvidia prime settings may have also changed.The package nextcloud17 has been removed and nextcloud18 was marked as insecure since both of them will will be EOL (end of life) within the lifetime of 20.09.
It’s necessary to upgrade to nextcloud19:
From nextcloud17, you have to upgrade to nextcloud18 first as Nextcloud doesn’t allow going multiple major revisions forward in a single upgrade. This is possible by setting services.nextcloud.package to nextcloud18.
From nextcloud18, it’s possible to directly upgrade to nextcloud19 by setting services.nextcloud.package to nextcloud19.
The GNOME desktop manager no longer default installs gnome3.epiphany. It was chosen to do this as it has a usability breaking issue (see issue #98819) that makes it unsuitable to be a default app.
Note
Issue #98819 is now fixed and gnome3.epiphany is once again installed by default.
If you want to manage the configuration of wpa_supplicant outside of NixOS you must ensure that none of networking.wireless.networks, networking.wireless.extraConfig or networking.wireless.userControlled.enable is being used or
true. Using any of those options will cause wpa_supplicant to be started with a NixOS generated configuration file instead of your own.
Other Notable Changes
SD images are now compressed by default using
zstd. The compression for ISO images has also been changed tozstd, but ISO images are still not compressed by default.services.journald.rateLimitBurstwas updated from1000to10000to follow the new upstream systemd default.The notmuch package moves its emacs-related binaries and emacs lisp files to a separate output. They’re not part of the default
outoutput anymore - if you relied on thenotmuch-emacs-muabinary or the emacs lisp files, access them via thenotmuch.emacsoutput.Device tree overlay support was improved in #79370 and now uses hardware.deviceTree.kernelPackage instead of
hardware.deviceTree.base. hardware.deviceTree.overlays configuration was extended to support.dtsfiles with symbols. Device trees can now be filtered by setting hardware.deviceTree.filter option.The default output of
buildGoPackageis now$outinstead of$bin.buildGoModuledoChecknow defaults totrue.Packages built using
buildRustPackagenow usereleasemode for thecheckPhaseby default.Please note that Rust packages utilizing a custom build/install procedure (e.g. by using a
Makefile) or test suites that rely on the structure of thetarget/directory may break due to those assumptions. For further information, please read the Rust section in the Nixpkgs manual.The cc- and binutils-wrapper’s “infix salt” and
_BUILD_and_TARGET_user infixes have been replaced with a “suffix salt” and suffixes and_FOR_BUILDand_FOR_TARGET. This matches the autotools convention for env vars which standard for these things, making interfacing with other tools easier.Additional Git documentation (HTML and text files) is now available via the
git-docpackage.Default algorithm for ZRAM swap was changed to
zstd.The installer now enables sshd by default. This improves installation on headless machines especially ARM single-board-computer. To login through ssh, either a password or an ssh key must be set for the root user or the nixos user.
The scripted networking system now uses
.linkfiles in/etc/systemd/networkto configure mac address and link MTU, instead of the sometimes buggynetwork-link-*units, which have been removed. Bringing the interface up has been moved to the beginning of thenetwork-addresses-*unit. Note this doesn’t requiresystemd-networkd- it’s udev that parses.linkfiles. Extra care needs to be taken in the presence of legacy udev rules to rename interfaces, as MAC Address and MTU defined in these options can only match on the original link name. In such cases, you most likely want to create a10-*.linkfile through systemd.network.links and set both name and MAC Address / MTU there.Grafana received a major update to version 7.x. A plugin is now needed for image rendering support, and plugins must now be signed by default. More information can be found in the Grafana documentation.
The
hardware.u2fmodule, which was installing udev rules was removed, as udev gained native support to handle FIDO security tokens.The
services.transmissionmodule was enhanced with the new options: services.transmission.credentialsFile, services.transmission.openFirewall, and services.transmission.performanceNetParameters.transmission-daemonis now started with additional systemd sandbox/hardening options for better security. Please report any use case where this is not working well. In particular, theRootDirectoryoption newly set forbids uploading or downloading a torrent outside of the default directory configured at settings.download-dir. If you really need Transmission to access other directories, you must include those directories into theBindPathsof the service:{ systemd.services.transmission.serviceConfig.BindPaths = [ "/path/to/alternative/download-dir" ]; }Also, connection to the RPC (Remote Procedure Call) of
transmission-daemonis now only available on the local network interface by default. Use:{ services.transmission.settings.rpc-bind-address = "0.0.0.0"; }to get the previous behavior of listening on all network interfaces.
With this release
systemd-networkd(when enabled through networking.useNetworkd) has it’s netlink socket created through asystemd.socketunit. This gives us control over socket buffer sizes and other parameters. For larger setups where networkd has to create a lot of (virtual) devices the default buffer size (currently 128MB) is not enough.On a machine with >100 virtual interfaces (e.g., wireguard tunnels, VLANs, …), that all have to be brought up during system startup, the receive buffer size will spike for a brief period. Eventually some of the message will be dropped since there is not enough (permitted) buffer space available.
By having
systemd-networkdstart with a netlink socket created bysystemdwe can configure theReceiveBufferSize=parameter in the socket options (i.e.systemd.sockets.systemd-networkd.socketOptions.ReceiveBufferSize) without recompilingsystemd-networkd.Since the actual memory requirements depend on hardware, timing, exact configurations etc. it isn’t currently possible to infer a good default from within the NixOS module system. Administrators are advised to monitor the logs of
systemd-networkdforrtnl: kernel receive buffer overrunspam and increase the memory limit as they see fit.Note: Increasing the
ReceiveBufferSize=doesn’t allocate any memory. It just increases the upper bound on the kernel side. The memory allocation depends on the amount of messages that are queued on the kernel side of the netlink socket.Specifying mailboxes in the dovecot2 module as a list is deprecated and will break eval in 21.05. Instead, an attribute-set should be specified where the
nameshould be the key of the attribute.This means that a configuration like this
{ services.dovecot2.mailboxes = [ { name = "Junk"; auto = "create"; } ]; }should now look like this:
{ services.dovecot2.mailboxes = { Junk.auto = "create"; }; }netbeans was upgraded to 12.0 and now defaults to OpenJDK 11. This might cause problems if your projects depend on packages that were removed in Java 11.
nextcloud has been updated to v19.
If you have an existing installation, please make sure that you’re on nextcloud18 before upgrading to nextcloud19 since Nextcloud doesn’t support upgrades across multiple major versions.
The
nixos-run-vmsscript now deletes the previous run machines states on test startup. You can use the--keep-vm-stateflag to match the previous behaviour and keep the same VM state between different test runs.The nix.buildMachines option is now type-checked. There are no functional changes, however this may require updating some configurations to use correct types for all attributes.
The
fontconfigmodule stopped generating config and cache files for fontconfig 2.10.x, the/etc/fonts/fonts.confnow belongs to the latest fontconfig, just like on other Linux distributions, and we will no longer be versioning the config directories.Fontconfig 2.10.x was removed from Nixpkgs since it hasn’t been used in any Nixpkgs package for years now.
Nginx module
nginxModules.fastcgi-cache-purgerenamed to official namenginxModules.cache-purge. Nginx modulenginxModules.ngx_aws_authrenamed to official namenginxModules.aws-auth.The option
defaultPackageswas added. It installs the packages perl, rsync and strace for now. They were added unconditionally tosystemPackagesbefore, but are not strictly necessary for a minimal NixOS install. You can set it to an empty list to have a more minimal system. Be aware that some functionality might still have an impure dependency on those packages, so things might break.The
undervoltoption no longer needs to apply its settings every 30s. If they still become undone, open an issue and restore the previous behaviour usingundervolt.useTimer.Agda has been heavily reworked.
agda.mkDerivationhas been heavily changed and is now located at agdaPackages.mkDerivation.New top-level packages agda and
agda.withPackageshave been added, the second of which sets up agda with access to chosen libraries.All agda libraries now live under
agdaPackages.Many broken libraries have been removed.
See the new documentation for more information.
The
deepinpackage set has been removed from nixpkgs. It was a work in progress to package the Deepin Desktop Environment (DDE), including libraries, tools and applications, and it was still missing a service to launch the desktop environment. It has shown to no longer be a feasible goal due to reasons discussed in issue #94870. The packagenetease-cloud-musichas also been removed, as it depends on libraries from deepin.The
opendkimmodule now uses systemd sandboxing features to limit the exposure of the system towards the opendkim service.Kubernetes has been upgraded to 1.19.1, which also means that the golang version to build it has been bumped to 1.15. This may have consequences for your existing clusters and their certificates. Please consider the release notes for Kubernetes 1.19 carefully before upgrading.
For AMD GPUs, Vulkan can now be used by adding
amdvlktohardware.opengl.extraPackages.Similarly, still for AMD GPUs, the ROCm OpenCL stack can now be used by adding
rocm-opencl-icdtohardware.opengl.extraPackages.
Contributions
I, Jonathan Ringer, would like to thank the following individuals for their work on nixpkgs. This release could not be done without the hard work of the NixOS community. There were 31282 contributions across 1313 contributors.
2288 Mario Rodas
1837 Frederik Rietdijk
946 Jörg Thalheim
925 Maximilian Bosch
687 Jonathan Ringer
651 Jan Tojnar
622 Daniël de Kok
605 WORLDofPEACE
597 Florian Klink
528 José Romildo Malaquias
281 volth
101 Robert Scott
86 Tim Steinbach
76 WORLDofPEACE
49 Maximilian Bosch
42 Thomas Tuegel
37 Doron Behar
36 Vladimír Čunát
27 Jonathan Ringer
27 Maciej Krüger
I, Jonathan Ringer, would also like to personally thank @WORLDofPEACE for their help in mentoring me on the release process. Special thanks also goes to Thomas Tuegel for helping immensely with stabilizing Qt, KDE, and Plasma5; I would also like to thank Robert Scott for his numerous fixes and pull request reviews.
Release 20.03 (“Markhor”, 2020.04/20)
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
Support is planned until the end of October 2020, handing over to 20.09.
Core version changes:
gcc: 8.3.0 -> 9.2.0
glibc: 2.27 -> 2.30
linux: 4.19 -> 5.4
mesa: 19.1.5 -> 19.3.3
openssl: 1.0.2u -> 1.1.1d
Desktop version changes:
plasma5: 5.16.5 -> 5.17.5
kdeApplications: 19.08.2 -> 19.12.3
gnome3: 3.32 -> 3.34
pantheon: 5.0 -> 5.1.3
Linux kernel is updated to branch 5.4 by default (from 4.19).
Grub is updated to 2.04, adding support for booting from F2FS filesystems and Btrfs volumes using zstd compression. Note that some users have been unable to boot after upgrading to 2.04 - for more information, please see this discussion.
Postgresql for NixOS service now defaults to v11.
The graphical installer image starts the graphical session automatically. Before you’d be greeted by a tty and asked to enter
systemctl start display-manager. It is now possible to disable the display-manager from running by selecting theDisable display-managerquirk in the boot menu.GNOME 3 has been upgraded to 3.34. Please take a look at their Release Notes for details.
If you enable the Pantheon Desktop Manager via
services.xserver.desktopManager.pantheon.enable, we now default to also use Pantheon’s newly designed greeter . Contrary to NixOS’s usual update policy, Pantheon will receive updates during the cycle of NixOS 20.03 when backwards compatible.By default zfs pools will now be trimmed on a weekly basis. Trimming is only done on supported devices (i.e. NVME or SSDs) and should improve throughput and lifetime of these devices. It is controlled by the
services.zfs.trim.enablevarname. The zfs scrub service (services.zfs.autoScrub.enable) and the zfs autosnapshot service (services.zfs.autoSnapshot.enable) are now only enabled if zfs is set inconfig.boot.initrd.supportedFilesystemsorconfig.boot.supportedFilesystems. These lists will automatically contain zfs as soon as any zfs mountpoint is configured infileSystems.nixos-optionhas been rewritten in C++, speeding it up, improving correctness, and adding a-roption which prints all options and their values recursively.services.xserver.desktopManager.defaultandservices.xserver.windowManager.defaultoptions were replaced by a single services.xserver.displayManager.defaultSession option to improve support for upstream session files. If you used something like:{ services.xserver.desktopManager.default = "xfce"; services.xserver.windowManager.default = "icewm"; }you should change it to:
{ services.xserver.displayManager.defaultSession = "xfce+icewm"; }The testing driver implementation in NixOS is now in Python
make-test-python.nix. This was done by Jacek Galowicz (@tfc), and with the collaboration of Julian Stecklina (@blitz) and Jana Traue (@jtraue). All documentation has been updated to use this testing driver, and a vast majority of the 286 tests in NixOS were ported to python driver. In 20.09 the Perl driver implementation,make-test.nix, is slated for removal. This should give users of the NixOS integration framework a transitory period to rewrite their tests to use the Python implementation. Users of the Perl driver will see this warning every time they use it:$ warning: Perl VM tests are deprecated and will be removed for 20.09. Please update your tests to use the python test driver. See https://github.com/NixOS/nixpkgs/pull/71684 for details.API compatibility is planned to be kept for at least the next release with the perl driver.
New Services
The following new services were added since the last release:
The kubernetes kube-proxy now supports a new hostname configuration
services.kubernetes.proxy.hostnamewhich has to be set if the hostname of the node should be non default.UPower’s configuration is now managed by NixOS and can be customized via
services.upower.To use Geary you should enable programs.geary.enable instead of just adding it to environment.systemPackages. It was created so Geary could function properly outside of GNOME.
./config/console.nix./hardware/brillo.nix./hardware/tuxedo-keyboard.nix./programs/bandwhich.nix./programs/bash-my-aws.nix./programs/liboping.nix./programs/traceroute.nix./services/backup/sanoid.nix./services/backup/syncoid.nix./services/backup/zfs-replication.nix./services/continuous-integration/buildkite-agents.nix./services/databases/victoriametrics.nix./services/desktops/gnome3/gnome-initial-setup.nix./services/desktops/neard.nix./services/games/openarena.nix./services/hardware/fancontrol.nix./services/mail/sympa.nix./services/misc/freeswitch.nix./services/misc/mame.nix./services/monitoring/do-agent.nix./services/monitoring/prometheus/xmpp-alerts.nix./services/network-filesystems/orangefs/server.nix./services/network-filesystems/orangefs/client.nix./services/networking/3proxy.nix./services/networking/corerad.nix./services/networking/go-shadowsocks2.nix./services/networking/ntp/openntpd.nix./services/networking/shorewall.nix./services/networking/shorewall6.nix./services/networking/spacecookie.nix./services/networking/trickster.nix./services/networking/v2ray.nix./services/networking/xandikos.nix./services/networking/yggdrasil.nix./services/web-apps/dokuwiki.nix./services/web-apps/gotify-server.nix./services/web-apps/grocy.nix./services/web-apps/ihatemoney./services/web-apps/moinmoin.nix./services/web-apps/trac.nix./services/web-apps/trilium.nix./services/web-apps/shiori.nix./services/web-servers/ttyd.nix./services/x11/picom.nix./services/x11/hardware/digimend.nix./services/x11/imwheel.nix./virtualisation/cri-o.nix
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
The dhcpcd package does not request IPv4 addresses for tap and bridge interfaces anymore by default. In order to still get an address on a bridge interface, one has to disable
networking.useDHCPand explicitly enablenetworking.interfaces.<name>.useDHCPon every interface, that should get an address via DHCP. This way, dhcpcd is configured in an explicit way about which interface to run on.GnuPG is now built without support for a graphical passphrase entry by default. Please enable the
gpg-agentuser service via the NixOS optionprograms.gnupg.agent.enable. Note that upstream recommends usinggpg-agentand will spawn agpg-agenton the first invocation of GnuPG anyway.The
dynamicHostsoption has been removed from the NetworkManager module. Allowing (multiple) regular users to override host entries affecting the whole system opens up a huge attack vector. There seem to be very rare cases where this might be useful. Consider setting system-wide host entries using networking.hosts, provide them via the DNS server in your network, or use environment.etc to add a file into/etc/NetworkManager/dnsmasq.dreconfiguringhostsdir.The
99-main.networkfile was removed. Matching all network interfaces caused many breakages, see #18962 and #71106.We already don’t support the global networking.useDHCP, networking.defaultGateway and networking.defaultGateway6 options if networking.useNetworkd is enabled, but direct users to configure the per-device networking.interfaces.<name>… options.
The stdenv now runs all bash with
set -u, to catch the use of undefined variables. Before, it itself usedset -ubut was careful to unset it so other packages’ code ran as before. Now, all bash code is held to the same high standard, and the rather complex stateful manipulation of the options can be discarded.The SLIM Display Manager has been removed, as it has been unmaintained since 2013. Consider migrating to a different display manager such as LightDM (current default in NixOS), SDDM, GDM, or using the startx module which uses Xinitrc.
The Way Cooler wayland compositor has been removed, as the project has been officially canceled. There are no more
way-coolerattribute andprograms.way-cooleroptions.The BEAM package set has been deleted. You will only find there the different interpreters. You should now use the different build tools coming with the languages with sandbox mode disabled.
There is now only one Xfce package-set and module. This means that attributes
xfce4-14andxfceUnstableall now point to the latest Xfce 4.14 packages. And in the future NixOS releases will be the latest released version of Xfce available at the time of the release’s development (if viable).The phpfpm module now sets
PrivateTmp=truein its systemd units for better process isolation. If you rely on/tmpbeing shared with other services, explicitly override this by settingserviceConfig.PrivateTmptofalsefor each phpfpm unit.KDE’s old multimedia framework Phonon no longer supports Qt 4. For that reason, Plasma desktop also does not have
enableQt4Supportoption any more.The BeeGFS module has been removed.
The osquery module has been removed.
Going forward,
~/binin the users home directory will no longer be inPATHby default. If you depend on this you should set the optionenvironment.homeBinInPathtotrue. The aforementioned option was added this release.The
buildRustCrateinfrastructure now producesliboutputs in addition to theoutoutput. This has led to drastically reduced closure sizes for some rust crates since development dependencies are now in theliboutput.Pango was upgraded to 1.44, which no longer uses freetype for font loading. This means that type1 and bitmap fonts are no longer supported in applications relying on Pango for font rendering (notably, GTK application). See upstream issue for more information.
The
roundcubemodule has been hardened.The password of the database is not written world readable in the store any more. If
database.hostis set tolocalhost, then a unix user of the same name as the database will be created and PostreSQL peer authentication will be used, removing the need for a password. Otherwise, a password is still needed and can be provided with the new optiondatabase.passwordFile, which should be set to the path of a file containing the password and readable by the usernginxonly. Thedatabase.passwordoption is insecure and deprecated. Usage of this option will print a warning.A random
des_keyis set by default in the configuration of roundcube, instead of using the hardcoded and insecure default. To ensure a clean migration, all users will be logged out when you upgrade to this release.
The packages
openobexandobexftpare no longer installed when enabling Bluetooth viahardware.bluetooth.enable.The
dump1090derivation has been changed to use FlightAware’s dump1090 as its upstream. However, this version does not have an internal webserver anymore. The assets in theshare/dump1090directory of the derivation can be used in conjunction with an external webserver to replace this functionality.The fourStore and fourStoreEndpoint modules have been removed.
Polkit no longer has the user of uid 0 (root) as an admin identity. We now follow the upstream default of only having every member of the wheel group admin privileged. Before it was root and members of wheel. The positive outcome of this is pkexec GUI popups or terminal prompts will no longer require the user to choose between two essentially equivalent choices (whether to perform the action as themselves with wheel permissions, or as the root user).
NixOS containers no longer build NixOS manual by default. This saves evaluation time, especially if there are many declarative containers defined. Note that this is already done when
<nixos/modules/profiles/minimal.nix>module is included in container config.The
kresdservices deprecates theinterfacesoption in favor of thelistenPlainoption which requires full systemd.socket compatible declaration which always include a port.Virtual console options have been reorganized and can be found under a single top-level attribute:
console. The full set of changes is as follows:i18n.consoleFontrenamed to console.fonti18n.consoleKeyMaprenamed to console.keyMapi18n.consoleColorsrenamed to console.colorsi18n.consolePackagesrenamed to console.packagesi18n.consoleUseXkbConfigrenamed to console.useXkbConfigboot.earlyVconsoleSetuprenamed to console.earlySetupboot.extraTTYsrenamed toconsole.extraTTYs.
The awstats module has been rewritten to serve stats via static html pages, updated on a timer, over nginx, instead of dynamic cgi pages over apache.
Minor changes will be required to migrate existing configurations. Details of the required changes can seen by looking through the awstats module.
The httpd module no longer provides options to support serving web content without defining a virtual host. As a result of this the services.httpd.logPerVirtualHost option now defaults to
trueinstead offalse. Please update your configuration to make use of services.httpd.virtualHosts.The services.httpd.virtualHosts.<name> option has changed type from a list of submodules to an attribute set of submodules, better matching services.nginx.virtualHosts.<name>.
This change comes with the addition of the following options which mimic the functionality of their
nginxcounterparts: services.httpd.virtualHosts.<name>.addSSL, services.httpd.virtualHosts.<name>.forceSSL, services.httpd.virtualHosts.<name>.onlySSL, services.httpd.virtualHosts.<name>.enableACME, services.httpd.virtualHosts.<name>.acmeRoot, and services.httpd.virtualHosts.<name>.useACMEHost.For NixOS configuration options, the
loaOftype has been deprecated and will be removed in a future release. In nixpkgs, options of this type will be changed toattrsOfinstead. If you were using one of these in your configuration, you will see a warning suggesting what changes will be required.For example, users.users is a
loaOfoption that is commonly used as follows:{ users.users = [ { name = "me"; description = "My personal user."; isNormalUser = true; } ]; }This should be rewritten by removing the list and using the value of
nameas the name of the attribute set:{ users.users.me = { description = "My personal user."; isNormalUser = true; }; }For more information on this change have look at these links: issue #1800, PR #63103.
For NixOS modules, the types
types.submoduleandtypes.submoduleWithnow support paths as allowed values, similar to howimportssupports paths. Because of this, if you have a module that defines an option of typeeither (submodule ...) path, it will break since a path is now treated as the first type instead of the second. To fix this, change the type toeither path (submodule ...).The Buildkite Agent module and corresponding packages have been updated to 3.x, and to support multiple instances of the agent running at the same time. This means you will have to rename
services.buildkite-agenttoservices.buildkite-agents.<name>. Furthermore, the following options have been changed:services.buildkite-agent.meta-datahas been renamed to services.buildkite-agents.<name>.tags, to match upstreams naming for 3.x. Its type has also changed - it now accepts an attrset of strings.The
services.buildkite-agent.openssh.publicKeyPathoption has been removed, as it’s not necessary to deploy public keys to clone private repositories.services.buildkite-agent.openssh.privateKeyPathhas been renamed to buildkite-agents.<name>.privateSshKeyPath, as the wholeopensshnow only contained that single option.services.buildkite-agents.<name>.shell has been introduced, allowing to specify a custom shell to be used.
The
citrix_workspace_19_3_0package has been removed as it will be EOLed within the lifespan of 20.03. For further information, please refer to the support and maintenance information from upstream.The
gcc5andgfortran5packages have been removed.The
services.xserver.displayManager.automodule has been removed. It was only intended for use in internal NixOS tests, and gave the false impression of it being a special display manager when it’s actually LightDM. Please use theservices.xserver.displayManager.lightdm.autoLoginoptions instead, or any other display manager in NixOS as they all support auto-login. If you used this module specifically because it permitted root auto-login you can override the lightdm-autologin pam module like:{ security.pam.services.lightdm-autologin.text = lib.mkForce '' auth requisite pam_nologin.so auth required pam_succeed_if.so quiet auth required pam_permit.so account include lightdm password include lightdm session include lightdm ''; }The difference is the:
auth required pam_succeed_if.so quietline, where default it’s:
auth required pam_succeed_if.so uid >= 1000 quietnot permitting users with uid’s below 1000 (like root). All other display managers in NixOS are configured like this.
There have been lots of improvements to the Mailman module. As a result,
The
services.mailman.hyperkittyBaseUrloption has been renamed to services.mailman.hyperkitty.baseUrl.The
services.mailman.hyperkittyApiKeyoption has been removed. This is because having an option for the Hyperkitty API key meant that the API key would be stored in the world-readable Nix store, which was a security vulnerability. A new Hyperkitty API key will be generated the first time the new Hyperkitty service is run, and it will then be persisted outside of the Nix store. To continue using Hyperkitty, you must set services.mailman.hyperkitty.enable totrue.Additionally, some Postfix configuration must now be set manually instead of automatically by the Mailman module:
{ services.postfix.relayDomains = [ "hash:/var/lib/mailman/data/postfix_domains" ]; services.postfix.config.transport_maps = [ "hash:/var/lib/mailman/data/postfix_lmtp" ]; services.postfix.config.local_recipient_maps = [ "hash:/var/lib/mailman/data/postfix_lmtp" ]; }This is because some users may want to include other values in these lists as well, and this was not possible if they were set automatically by the Mailman module. It would not have been possible to just concatenate values from multiple modules each setting the values they needed, because the order of elements in the list is significant.
The LLVM versions 3.5, 3.9 and 4 (including the corresponding CLang versions) have been dropped.
The
networking.interfaces.*.preferTempAddressoption has been replaced bynetworking.interfaces.*.tempAddress. The new option allows better control of the IPv6 temporary addresses, including completely disabling them for interfaces where they are not needed.Rspamd was updated to version 2.2. Read the upstream migration notes carefully. Please be especially aware that some modules were removed and the default Bayes backend is now Redis.
The
*psuversions of oraclejdk8 have been removed as they aren’t provided by upstream anymore.The
services.dnscrypt-proxymodule has been removed as it used the deprecated version of dnscrypt-proxy. We’ve added services.dnscrypt-proxy2.enable to use the supported version. This module supports configuration via the Nix attribute set services.dnscrypt-proxy2.settings, or by passing a TOML configuration file via services.dnscrypt-proxy2.configFile.{ # Example configuration: services.dnscrypt-proxy2.enable = true; services.dnscrypt-proxy2.settings = { listen_addresses = [ "127.0.0.1:43" ]; sources.public-resolvers = { urls = [ "https://download.dnscrypt.info/resolvers-list/v2/public-resolvers.md" ]; cache_file = "public-resolvers.md"; minisign_key = "RWQf6LRCGA9i53mlYecO4IzT51TGPpvWucNSCh1CBM0QTaLn73Y7GFO3"; refresh_delay = 72; }; }; services.dnsmasq.enable = true; services.dnsmasq.servers = [ "127.0.0.1#43" ]; }qesteidutilhas been deprecated in favor ofqdigidoc.sqldeveloper_18 has been removed as it’s not maintained anymore, sqldeveloper has been updated to version
19.4. Please note that this means that this means that the oraclejdk is now required. For further information please read the release notes.Haskell
envandshellFordev shell environments now organize dependencies the same way as regular builds. In particular, rather than receiving all the different lists of dependencies mashed together as one big list, and then partitioning into Haskell and non-Hakell dependencies, they work from the original many different dependency parameters and don’t need to algorithmically partition anything.This means that if you incorrectly categorize a dependency, e.g. non-Haskell library dependency as a
buildDependsor run-time Haskell dependency as asetupDepends, whereas things would have worked before they may not work now.The gcc-snapshot-package has been removed. It’s marked as broken for >2 years and used to point to a fairly old snapshot from the gcc7-branch.
The nixos-build-vms8 -script now uses the python test-driver.
The riot-web package now accepts configuration overrides as an attribute set instead of a string. A formerly used JSON configuration can be converted to an attribute set with
builtins.fromJSON.The new default configuration also disables automatic guest account registration and analytics to improve privacy. The previous behavior can be restored by setting
config.riot-web.conf = { disable_guests = false; piwik = true; }.Stand-alone usage of
Upowernow requiresservices.upower.enableinstead of just installing into environment.systemPackages.nextcloud has been updated to
v18.0.2. This means that users from NixOS 19.09 can’t upgrade directly since you can only move one version forward and 19.09 usesv16.0.8.To provide a safe upgrade-path and to circumvent similar issues in the future, the following measures were taken:
The pkgs.nextcloud-attribute has been removed and replaced with versioned attributes (currently pkgs.nextcloud17 and pkgs.nextcloud18). With this change major-releases can be backported without breaking stuff and to make upgrade-paths easier.
Existing setups will be detected using system.stateVersion: by default, nextcloud17 will be used, but will raise a warning which notes that after that deploy it’s recommended to update to the latest stable version (nextcloud18) by declaring the newly introduced setting services.nextcloud.package.
Users with an overlay (e.g. to use nextcloud at version
v18on19.09) will get an evaluation error by default. This is done to ensure that our package-option doesn’t select an older version by accident. It’s recommended to use pkgs.nextcloud18 or to set package to pkgs.nextcloud explicitly.
Warning
Please note that if you’re coming from
19.03or older, you have to manually upgrade to19.09first to upgrade your server to Nextcloud v16.Hydra has gained a massive performance improvement due to some database schema changes by adding several IDs and better indexing. However, it’s necessary to upgrade Hydra in multiple steps:
At first, an older version of Hydra needs to be deployed which adds those (nullable) columns. When having set stateVersion to a value older than
20.03, this package will be selected by default from the module when upgrading. Otherwise, the package can be deployed using the following config:{ pkgs, ... }: { services.hydra.package = pkgs.hydra-migration; }
Automatically fill the newly added ID columns on the server by running the following command:
$ hydra-backfill-idsWarning
Please note that this process can take a while depending on your database-size!
Deploy a newer version of Hydra to activate the DB optimizations. This can be done by using hydra-unstable. This package already includes flake-support and is therefore compiled against pkgs.nixFlakes.
Warning
If your stateVersion is set to
20.03or greater, hydra-unstable will be used automatically! This will break your setup if you didn’t run the migration.Please note that Hydra is currently not available with nixStable as this doesn’t compile anymore.
Warning
pkgs.hydra has been removed to ensure a graceful database-migration using the dedicated package-attributes. If you still have pkgs.hydra defined in e.g. an overlay, an assertion error will be thrown. To circumvent this, you need to set services.hydra.package to pkgs.hydra explicitly and make sure you know what you’re doing!
The TokuDB storage engine will be disabled in mariadb 10.5. It is recommended to switch to RocksDB. See also TokuDB.
Other Notable Changes
SD images are now compressed by default using
bzip2.The nginx web server previously started its master process as root privileged, then ran worker processes as a less privileged identity user (the
nginxuser). This was changed to start all of nginx as a less privileged user (defined byservices.nginx.userandservices.nginx.group). As a consequence, all files that are needed for nginx to run (included configuration fragments, SSL certificates and keys, etc.) must now be readable by this less privileged user/group.To continue to use the old approach, you can configure:
{ services.nginx.appendConfig = let cfg = config.services.nginx; in "user ${cfg.user} ${cfg.group};"; systemd.services.nginx.serviceConfig.User = lib.mkForce "root"; }OpenSSH has been upgraded from 7.9 to 8.1, improving security and adding features but with potential incompatibilities. Consult the release announcement for more information.
PRETTY_NAMEin/etc/os-releasenow uses the short rather than full version string.The ACME module has switched from simp-le to lego which allows us to support DNS-01 challenges and wildcard certificates. The following options have been added: security.acme.acceptTerms, security.acme.certs.<name>.dnsProvider, security.acme.certs.<name>.credentialsFile, security.acme.certs.<name>.dnsPropagationCheck. As well as this, the options
security.acme.acceptTermsand eithersecurity.acme.emailorsecurity.acme.certs.<name>.emailmust be set in order to use the ACME module. Certificates will be regenerated on activation, no account or certificate will be migrated from simp-le. In particular private keys will not be preserved. However, the credentials for simp-le are preserved and thus it is possible to roll back to previous versions without breaking certificate generation. Note also that in contrary to simp-le a new private key is recreated at each renewal by default, which can have consequences if you embed your public key in apps.It is now possible to unlock LUKS-Encrypted file systems using a FIDO2 token via
boot.initrd.luks.fido2Support.Predictably named network interfaces get renamed in stage-1. This means that it is possible to use the proper interface name for e.g. Dropbear setups.
For further reference, please read #68953 or the corresponding discourse thread.
The matrix-synapse-package has been updated to v1.11.1. Due to stricter requirements for database configuration when using postgresql, the automated database setup of the module has been removed to avoid any further edge-cases.
matrix-synapse expects
postgresql-databases to have the optionsLC_COLLATEandLC_CTYPEset to'C'which basically instructspostgresqlto ignore any locale-based preferences.Depending on your setup, you need to incorporate one of the following changes in your setup to upgrade to 20.03:
If you use
sqlite3you don’t need to do anything.If you use
postgresqlon a different server, you don’t need to change anything as well since this module was never designed to configure remote databases.If you use
postgresqland configured your synapse initially on19.09or older, you need to enable postgresql-support explicitly:{ ... }: { services.matrix-synapse = { enable = true; # and all the other config you've defined here }; services.postgresql.enable = true; }
If you deploy a fresh matrix-synapse, you need to configure the database yourself (e.g. by using the services.postgresql.initialScript option). An example for this can be found in the documentation of the Matrix module.
If you initially deployed your matrix-synapse on
nixos-unstableafter the19.09-release, your database is misconfigured due to a regression in NixOS. For now, matrix-synapse will startup with a warning, but it’s recommended to reconfigure the database to set the valuesLC_COLLATEandLC_CTYPEto'C'.The systemd.network.links option is now respected even when systemd-networkd is disabled. This mirrors the behaviour of systemd - It’s udev that parses
.linkfiles, notsystemd-networkd.mongodb has been updated to version
3.4.24.Warning
Please note that mongodb has been relicensed under their own
sspl-license. Since it’s not entirely free and not OSI-approved, it’s listed as non-free. This means that Hydra doesn’t provide prebuilt mongodb-packages and needs to be built locally.
Release 19.09 (“Loris”, 2019/10/09)
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
End of support is planned for end of April 2020, handing over to 20.03.
Nix has been updated to 2.3; see its release notes.
Core version changes:
systemd: 239 -> 243
gcc: 7 -> 8
glibc: 2.27 (unchanged)
linux: 4.19 LTS (unchanged)
openssl: 1.0 -> 1.1
Desktop version changes:
plasma5: 5.14 -> 5.16
gnome3: 3.30 -> 3.32
PHP now defaults to PHP 7.3, updated from 7.2.
PHP 7.1 is no longer supported due to upstream not supporting this version for the entire lifecycle of the 19.09 release.
The binfmt module is now easier to use. Additional systems can be added through
boot.binfmt.emulatedSystems. For instance,boot.binfmt.emulatedSystems = [ "wasm32-wasi" "x86_64-windows" "aarch64-linux" ];will set up binfmt interpreters for each of those listed systems.The installer now uses a less privileged
nixosuser whereas before we logged in as root. To gain root privileges usesudo -iwithout a password.We’ve updated to Xfce 4.14, which brings a new module
services.xserver.desktopManager.xfce4-14. If you’d like to upgrade, please switch from theservices.xserver.desktopManager.xfcemodule as it will be deprecated in a future release. They’re incompatibilities with the current Xfce module; it doesn’t supportthunarPluginsand it isn’t recommended to useservices.xserver.desktopManager.xfceandservices.xserver.desktopManager.xfce4-14simultaneously or to downgrade from Xfce 4.14 after upgrading.The GNOME 3 desktop manager module sports an interface to enable/disable core services, applications, and optional GNOME packages like games.
services.gnome3.core-os-services.enableservices.gnome3.core-shell.enableservices.gnome3.core-utilities.enableservices.gnome3.games.enable
With these options we hope to give users finer grained control over their systems. Prior to this change you’d either have to manually disable options or use
environment.gnome3.excludePackageswhich only excluded the optional applications.environment.gnome3.excludePackagesis now unguarded, it can exclude any package installed withenvironment.systemPackagesin the GNOME 3 module.Orthogonal to the previous changes to the GNOME 3 desktop manager module, we’ve updated all default services and applications to match as close as possible to a default reference GNOME 3 experience.
The following changes were enacted in
services.gnome3.core-utilities.enableaccerciserdconf-editorevolutiongnome-documentsgnome-nettoolgnome-power-managergnome-todognome-tweaksgnome-usagegucharmapnautilus-sendtovinagrecheesegeary
The following changes were enacted in
services.gnome3.core-shell.enablegnome-color-managerorcaservices.avahi.enable
New Services
The following new services were added since the last release:
./programs/dwm-status.nixThe new
hardware.printersmodule allows to declaratively configure CUPS printers via theensurePrintersandensureDefaultPrinteroptions.ensurePrinterswill never delete existing printers, but will make sure that the given printers are configured as declared.There is a new services.system-config-printer.enable and programs.system-config-printer.enable module for the program of the same name. If you previously had
system-config-printerenabled through some other means you should migrate to using one of these modules.services.xserver.desktopManager.plasma5services.xserver.desktopManager.gnome3services.xserver.desktopManager.pantheonservices.xserver.desktopManager.mateNote Mate usesprograms.system-config-printeras it doesn’t use it as a service, but its graphical interface directly.
services.blueman.enable has been added. If you previously had blueman installed via
environment.systemPackagesplease migrate to using the NixOS module, as this would result in an insufficiently configured blueman.
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
Buildbot no longer supports Python 2, as support was dropped upstream in version 2.0.0. Configurations may need to be modified to make them compatible with Python 3.
PostgreSQL now uses
/run/postgresqlas its socket directory instead of/tmp. So if you run an application like eg. Nextcloud, where you need to use the Unix socket path as the database host name, you need to change it accordingly.PostgreSQL 9.4 is scheduled EOL during the 19.09 life cycle and has been removed.
The options
services.prometheus.alertmanager.userandservices.prometheus.alertmanager.grouphave been removed because the alertmanager service is now using systemd’s DynamicUser mechanism which obviates these options.The NetworkManager systemd unit was renamed back from network-manager.service to NetworkManager.service for better compatibility with other applications expecting this name. The same applies to ModemManager where modem-manager.service is now called ModemManager.service again.
The
services.nzbget.configFileandservices.nzbget.openFirewalloptions were removed as they are managed internally by the nzbget. Theservices.nzbget.dataDiroption hadn’t actually been used by the module for some time and so was removed as cleanup.The
services.mysql.pidDiroption was removed, as it was only used by the wordpress apache-httpd service to wait for mysql to have started up. This can be accomplished by either describing a dependency on mysql.service (preferred) or waiting for the (hardcoded)/run/mysqld/mysql.sockfile to appear.The
services.emby.enablemodule has been removed, seeservices.jellyfin.enableinstead for a free software fork of Emby. See the Jellyfin documentation: Migrating from Emby to JellyfinIPv6 Privacy Extensions are now enabled by default for undeclared interfaces. The previous behaviour was quite misleading — even though the default value for
networking.interfaces.*.preferTempAddresswastrue, undeclared interfaces would not prefer temporary addresses. Now, interfaces not mentioned in the config will prefer temporary addresses. EUI64 addresses can still be set as preferred by explicitly setting the option tofalsefor the interface in question.Since Bittorrent Sync was superseded by Resilio Sync in 2016, the
bittorrentSync,bittorrentSync14, andbittorrentSync16packages have been removed in favor ofresilio-sync.The corresponding module,
services.btsynchas been replaced by theservices.resiliomodule.The httpd service no longer attempts to start the postgresql service. If you have come to depend on this behaviour then you can preserve the behavior with the following configuration:
systemd.services.httpd.after = [ "postgresql.service" ];The option
services.httpd.extraSubserviceshas been marked as deprecated. You may still use this feature, but it will be removed in a future release of NixOS. You are encouraged to convert any httpd subservices you may have written to a full NixOS module.Most of the httpd subservices packaged with NixOS have been replaced with full NixOS modules including LimeSurvey, WordPress, and Zabbix. These modules can be enabled using the
services.limesurvey.enable,services.mediawiki.enable,services.wordpress.enable, andservices.zabbixWeb.enableoptions.The option
systemd.network.networks.<name>.routes.*.routeConfig.GatewayOnlinkwas renamed tosystemd.network.networks.<name>.routes.*.routeConfig.GatewayOnLink(capitalL). This follows upstreams renaming of the setting.As of this release the NixOps feature
autoLuksis deprecated. It no longer works with our systemd version without manual intervention.Whenever the usage of the module is detected the evaluation will fail with a message explaining why and how to deal with the situation.
A new knob named
nixops.enableDeprecatedAutoLukshas been introduced to disable the eval failure and to acknowledge the notice was received and read. If you plan on using the feature please note that it might break with subsequent updates.Make sure you set the
_netdevoption for each of the file systems referring to block devices provided by the autoLuks module. Not doing this might render the system in a state where it doesn’t boot anymore.If you are actively using the
autoLuksmodule please let us know in issue #62211.The setopt declarations will be evaluated at the end of
/etc/zshrc, so any code in programs.zsh.interactiveShellInit, programs.zsh.loginShellInit and programs.zsh.promptInit may break if it relies on those options being set.The
prometheus-nginx-exporterpackage now uses the official exporter provided by NGINX Inc. Its metrics are differently structured and are incompatible to the old ones. For information about the metrics, have a look at the official repo.The
shibboleth-sppackage has been updated to version 3. It is largely backward compatible, for further information refer to the release notes and upgrade guide.Nodejs 8 is scheduled EOL under the lifetime of 19.09 and has been dropped.
By default, prometheus exporters are now run with
DynamicUserenabled. Exporters that need a real user, now run under a separate user and group which follow the pattern<exporter-name>-exporter, instead of the previous defaultnobodyandnogroup. Only some exporters are affected by the latter, namely the exportersdovecot,node,postfixandvarnish.The
ibus-qtpackage is not installed by default anymore when i18n.inputMethod.enabled is set toibus. If IBus support in Qt 4.x applications is required, add theibus-qtpackage to your environment.systemPackages manually.The CUPS Printing service now uses socket-based activation by default, only starting when needed. The previous behavior can be restored by setting
services.cups.startWhenNeededtofalse.The
services.systemhealthmodule has been removed from nixpkgs due to lack of maintainer.The
services.mantisbtmodule has been removed from nixpkgs due to lack of maintainer.Squid 3 has been removed and the
squidderivation now refers to Squid 4.The
services.pdns-recursor.extraConfigoption has been replaced byservices.pdns-recursor.settings. The new option allows setting extra configuration while being better type-checked and mergeable.No service depends on
keys.targetanymore which is a systemd target that indicates if all NixOps keys were successfully uploaded. Instead,<key-name>-key.serviceshould be used to define a dependency of a key in a service. The full issue behind thekeys.targetdependency is described at NixOS/nixpkgs#67265.The following services are affected by this:
The
security.acme.directoryoption has been replaced by a read-onlysecurity.acme.certs.<cert>.directoryoption for each certificate you define. This will be a subdirectory of/var/lib/acme. You can use this read-only option to figure out where the certificates are stored for a specific certificate. For example, theservices.nginx.virtualhosts.<name>.enableACMEoption will use this directory option to find the certs for the virtual host.security.acme.preDelayandsecurity.acme.activationDelayoptions have been removed. To execute a service before certificates are provisioned or renewed add aRequiredBy=acme-${cert}.serviceto any service.Furthermore, the acme module will not automatically add a dependency on
lighttpd.serviceanymore. If you are using certificates provided by letsencrypt for lighttpd, then you should depend on the certificate serviceacme-${cert}.service>manually.For nginx, the dependencies are still automatically managed when
services.nginx.virtualhosts.<name>.enableACMEis enabled just like before. What changed is that nginx now directly depends on the specific certificates that it needs, instead of depending on the catch-allacme-certificates.target. This target unit was also removed from the codebase. This will mean nginx will no longer depend on certificates it isn’t explicitly managing and fixes a bug with certificate renewal ordering racing with nginx restarting which could lead to nginx getting in a broken state as described at NixOS/nixpkgs#60180.The old deprecated
emacspackage sets have been dropped. What used to be calledemacsPackagesNgis now calledemacsPackages.services.xserver.desktopManager.xtermis now disabled by default ifstateVersionis 19.09 or higher. Previously the xterm desktopManager was enabled when xserver was enabled, but it isn’t useful for all people so it didn’t make sense to have any desktopManager enabled default.The WeeChat plugin
pkgs.weechatScripts.weechat-xmpphas been removed as it doesn’t receive any updates from upstream and depends on outdated Python2-based modules.Old unsupported versions (
logstash5,kibana5,filebeat5,heartbeat5,metricbeat5,packetbeat5) of the ELK-stack and Elastic beats have been removed.For NixOS 19.03, both Prometheus 1 and 2 were available to allow for a seamless transition from version 1 to 2 with existing setups. Because Prometheus 1 is no longer developed, it was removed. Prometheus 2 is now configured with
services.prometheus.Citrix Receiver (
citrix_receiver) has been dropped in favor of Citrix Workspace (citrix_workspace).The
services.gitlabmodule has had its literal secret options (services.gitlab.smtp.password,services.gitlab.databasePassword,services.gitlab.initialRootPassword,services.gitlab.secrets.secret,services.gitlab.secrets.db,services.gitlab.secrets.otpandservices.gitlab.secrets.jws) replaced by file-based versions (services.gitlab.smtp.passwordFile,services.gitlab.databasePasswordFile,services.gitlab.initialRootPasswordFile,services.gitlab.secrets.secretFile,services.gitlab.secrets.dbFile,services.gitlab.secrets.otpFileandservices.gitlab.secrets.jwsFile). This was done so that secrets aren’t stored in the world-readable nix store, but means that for each option you’ll have to create a file with the same exact string, add “File” to the end of the option name, and change the definition to a string pointing to the corresponding file; e.g.services.gitlab.databasePassword = "supersecurepassword"becomesservices.gitlab.databasePasswordFile = "/path/to/secret_file"where the filesecret_filecontains the stringsupersecurepassword.The state path (
services.gitlab.statePath) now has the following restriction: no parent directory can be owned by any other user thanrootor the user specified inservices.gitlab.user; i.e. ifservices.gitlab.statePathis set to/var/lib/gitlab/state,gitlaband all parent directories must be owned by eitherrootor the user specified inservices.gitlab.user.The
networking.useDHCPoption is unsupported in combination withnetworking.useNetworkdin anticipation of defaulting to it. It has to be set tofalseand enabled per interface withnetworking.interfaces.<name>.useDHCP = true;The Twitter client
corebirdhas been dropped as it is discontinued and does not work against the new Twitter API. Please use the forkcawbirdinstead which has been adapted to the API changes and is still maintained.The
nodejs-11_xpackage has been removed as it’s EOLed by upstream.Because of the systemd upgrade, systemd-timesyncd will no longer work if
system.stateVersionis not set correctly. When upgrading from NixOS 19.03, please make sure thatsystem.stateVersionis set to"19.03", or lower if the installation dates back to an earlier version of NixOS.Due to the short lifetime of non-LTS kernel releases package attributes like
linux_5_1,linux_5_2andlinux_5_3have been removed to discourage dependence on specific non-LTS kernel versions in stable NixOS releases. Going forward, versioned attributes likelinux_4_9will exist for LTS versions only. Please uselinux_latestorlinux_testingif you depend on non-LTS releases. Keep in mind thatlinux_latestandlinux_testingwill change versions under the hood during the lifetime of a stable release and might include breaking changes.Because of the systemd upgrade, some network interfaces might change their name. For details see upstream docs or our ticket.
Other Notable Changes
The
documentationmodule gained an option nameddocumentation.nixos.includeAllModuleswhich makes the generated configuration.nix 5 manual page include all options from all NixOS modules included in a givenconfiguration.nixconfiguration file. Currently, it is set tofalseby default as enabling it frequently prevents evaluation. But the plan is to eventually have it set totrueby default. Please set it totruenow in yourconfiguration.nixand fix all the bugs it uncovers.The
vlcpackage gained support for Chromecast streaming, enabled by default. TCP port 8010 must be open for it to work, so something likenetworking.firewall.allowedTCPPorts = [ 8010 ];may be required in your configuration. Also consider enabling Accelerated Video Playback for better transcoding performance.The following changes apply if the
stateVersionis changed to 19.09 or higher. ForstateVersion = "19.03"or lower the old behavior is preserved.solr.packagedefaults topkgs.solr_8.
The
hunspellDicts.fr-anydictionary now ships withfr_FR.{aff,dic}which is linked tofr-toutesvariantes.{aff,dic}.The
mysqlservice now runs asmysqluser. Previously, systemd did execute it as root, and mysql dropped privileges itself. This includesExecStartPre=andExecStartPost=phases. To accomplish that, runtime and data directory setup was delegated to RuntimeDirectory and tmpfiles.With the upgrade to systemd version 242 the
systemd-timesyncdservice is no longer usingDynamicUser=yes. In order for the upgrade to work we rely on an activation script to move the state from the old to the new directory. The older directory (prior19.09) was/var/lib/private/systemd/timesync.As long as the
system.config.stateVersionis below19.09the state folder will migrated to its proper location (/var/lib/systemd/timesync), if required.The package
avahiis now built to look up service definitions from/etc/avahi/servicesinstead of its output directory in the nix store. Accordingly the moduleavahinow supports custom service definitions viaservices.avahi.extraServiceFiles, which are then placed in the aforementioned directory. See avahi.service5 for more information on custom service definitions.Since version 0.1.19,
cargo-vendorhonors package includes that are specified in theCargo.tomlfile of Rust crates.rustPlatform.buildRustPackageusescargo-vendorto collect and build dependent crates. Since this change incargo-vendorchanges the set of vendored files for most Rust packages, the hash that use used to verify the dependencies,cargoSha256, also changes.The
cargoSha256hashes of all in-tree derivations that usebuildRustPackagehave been updated to reflect this change. However, third-party derivations that usebuildRustPackagemay have to be updated as well.The
consulpackage was upgraded past version1.5, so its deprecated legacy UI is no longer available.The default resample-method for PulseAudio has been changed from the upstream default
speex-float-1tospeex-float-5. Be aware that low-powered ARM-based and MIPS-based boards will struggle with this so you’ll need to sethardware.pulseaudio.daemon.config.resample-methodback tospeex-float-1.The
phabricatorpackage and associatedhttpd.extraSubservice, as well as thephdservice have been removed from nixpkgs due to lack of maintainer.The
mercurialhttpd.extraSubservicehas been removed from nixpkgs due to lack of maintainer.The
trachttpd.extraSubservicehas been removed from nixpkgs because it was unmaintained.The
foswikipackage and associatedhttpd.extraSubservicehave been removed from nixpkgs due to lack of maintainer.The
tomcat-connectorhttpd.extraSubservicehas been removed from nixpkgs.It’s now possible to change configuration in services.nextcloud after the initial deploy since all config parameters are persisted in an additional config file generated by the module. Previously core configuration like database parameters were set using their imperative installer after creating
/var/lib/nextcloud.There exists now
lib.forEach, which is likemap, but with arguments flipped. When mapping function body spans many lines (or has nestedmaps), it is often hard to follow which list is modified.Previous solution to this problem was either to use
lib.flip mapidiom or extract that anonymous mapping function to a named one. Both can still be used butlib.forEachis preferred overlib.flip map.The
/etc/sysctl.d/nixos.conffile containing all the options set via boot.kernel.sysctl was moved to/etc/sysctl.d/60-nixos.conf, as sysctl.d5 recommends prefixing all filenames in/etc/sysctl.dwith a two-digit number and a dash to simplify the ordering of the files.We now install the sysctl snippets shipped with systemd.
Loose reverse path filtering
Source route filtering
fq_codelas a packet scheduler (this helps to fight bufferbloat)
This also configures the kernel to pass core dumps to
systemd-coredump, and restricts the SysRq key combinations to the sync command only. These sysctl snippets can be found in/etc/sysctl.d/50-*.conf, and overridden via boot.kernel.sysctl (which will place the parameters in/etc/sysctl.d/60-nixos.conf).Core dumps are now processed by
systemd-coredumpby default.systemd-coredumpbehaviour can still be modified viasystemd.coredump.extraConfig. To stick to the old behaviour (having the kernel dump to a file calledcorein the working directory), without piping it throughsystemd-coredump, setsystemd.coredump.enabletofalse.systemd.packagesoption now also supports generators and shutdown scripts. Oldsystemd.generator-packagesoption has been removed.The
rmilterpackage was removed with associated module and options due deprecation by upstream developer. Userspamdin proxy mode instead.systemd cgroup accounting via the systemd.enableCgroupAccounting option is now enabled by default. It now also enables the more recent Block IO and IP accounting features.
We no longer enable custom font rendering settings with
fonts.fontconfig.penultimate.enableby default. The defaults from fontconfig are sufficient.The
crashplanpackage and thecrashplanservice have been removed from nixpkgs due to crashplan shutting down the service, while thecrashplansbpackage andcrashplan-small-businessservice have been removed from nixpkgs due to lack of maintainer.The redis module was hardcoded to use the
redisuser,/run/redisas runtime directory and/var/lib/redisas state directory. Note that the NixOS module for Redis now disables kernel support for Transparent Huge Pages (THP), because this features causes major performance problems for Redis, e.g. (https://redis.io/topics/latency).Using
fonts.enableDefaultFontsadds a default emoji fontnoto-fonts-emoji.services.xserver.enableprograms.sway.enableprograms.way-cooler.enableservices.xrdp.enable
The
altcoinscategorization of packages has been removed. You now access these packages at the top level, ie.nix-shell -p dogecoininstead ofnix-shell -p altcoins.dogecoin, etc.Ceph has been upgraded to v14.2.1. See the release notes for details. The mgr dashboard as well as osds backed by loop-devices is no longer explicitly supported by the package and module. Note: There’s been some issues with python-cherrypy, which is used by the dashboard and prometheus mgr modules (and possibly others), hence 0000-dont-check-cherrypy-version.patch.
pkgs.weechatis now compiled againstpkgs.python3. Weechat also recommends to use Python3 in their docs.
Release 19.03 (“Koi”, 2019/04/11)
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
End of support is planned for end of October 2019, handing over to 19.09.
The default Python 3 interpreter is now CPython 3.7 instead of CPython 3.6.
Added the Pantheon desktop environment. It can be enabled through
services.xserver.desktopManager.pantheon.enable.Note
By default,
services.xserver.desktopManager.pantheonenables LightDM as a display manager, as pantheon’s screen locking implementation relies on it. Because of that it is recommended to leave LightDM enabled. If you’d like to disable it anyway, setservices.xserver.displayManager.lightdm.enabletofalseand enable your preferred display manager.Also note that Pantheon’s LightDM greeter is not enabled by default, because it has numerous issues in NixOS and isn’t optimal for use here yet.
A major refactoring of the Kubernetes module has been completed. Refactorings primarily focus on decoupling components and enhancing security. Two-way TLS and RBAC has been enabled by default for all components, which slightly changes the way the module is configured. See: Kubernetes for details.
There is now a set of
confinementoptions forsystemd.services, which allows to restrict services into a chroot 2 ed environment that only contains the store paths from the runtime closure of the service.
New Services
The following new services were added since the last release:
./programs/nm-applet.nixThere is a new
security.googleOsLoginmodule for using OS Login to manage SSH access to Google Compute Engine instances, which supersedes the imperative and brokengoogle-accounts-daemonused innixos/modules/virtualisation/google-compute-config.nix../services/misc/beanstalkd.nixThere is a new
services.cockroachdbmodule for running CockroachDB databases. NixOS now ships with CockroachDB 2.1.x as well, available onx86_64-linuxandaarch64-linux../security/duosec.nixThe PAM module for Duo Security has been enabled for use. One can configure it using the
security.duosecoptions along with the corresponding PAM option insecurity.pam.services.<name?>.duoSecurity.enable.
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
The minimum version of Nix required to evaluate Nixpkgs is now 2.0.
For users of NixOS 18.03 and 19.03, NixOS defaults to Nix 2.0, but supports using Nix 1.11 by setting
nix.package = pkgs.nix1;. If this option is set to a Nix 1.11 package, you will need to either unset the option or upgrade it to Nix 2.0.For users of NixOS 17.09, you will first need to upgrade Nix by setting
nix.package = pkgs.nixStable2;and runnixos-rebuild switchas therootuser.For users of a daemon-less Nix installation on Linux or macOS, you can upgrade Nix by running
curl -L https://nixos.org/nix/install | sh, or prior to doing a channel update, runningnix-env -iA nix. If you have already run a channel update and Nix is no longer able to evaluate Nixpkgs, the error message printed should provide adequate directions for upgrading Nix.For users of the Nix daemon on macOS, you can upgrade Nix by running
sudo -i sh -c 'nix-channel --update && nix-env -iA nixpkgs.nix'; sudo launchctl stop org.nixos.nix-daemon; sudo launchctl start org.nixos.nix-daemon.
The
buildPythonPackagefunction now setsstrictDeps = trueto help distinguish between native and non-native dependencies in order to improve cross-compilation compatibility. Note however that this may break user expressions.The
buildPythonPackagefunction now setsLANG = C.UTF-8to enable Unicode support. TheglibcLocalespackage is no longer needed as a build input.The Syncthing state and configuration data has been moved from
services.syncthing.dataDirto the newly definedservices.syncthing.configDir, which default to/var/lib/syncthing/.config/syncthing. This change makes possible to share synced directories using ACLs without Syncthing resetting the permission on every start.The
ntpmodule now has sane default restrictions. If you’re relying on the previous defaults, which permitted all queries and commands from all firewall-permitted sources, you can setservices.ntp.restrictDefaultandservices.ntp.restrictSourceto[].Package
rabbitmq_serveris renamed torabbitmq-server.The
lightmodule no longer uses setuid binaries, but udev rules. As a consequence users of that module have to belong to thevideogroup in order to use the executable (i.e.users.users.yourusername.extraGroups = ["video"];).Buildbot now supports Python 3 and its packages have been moved to
pythonPackages. The optionsservices.buildbot-master.packageandservices.buildbot-worker.packagecan be used to select the Python 2 or 3 version of the package.Options
services.znc.confOptions.networks.name.userNameandservices.znc.confOptions.networks.name.modulePackageswere removed. They were never used for anything and can therefore safely be removed.Package
wasmhas been renamedproglodyte-wasm. The packagewasmwill be pointed toocamlPackages.wasmin 19.09, so make sure to update your configuration if you want to keepproglodyte-wasmWhen the
nixpkgs.pkgsoption is set, NixOS will no longer ignore thenixpkgs.overlaysoption. The old behavior can be recovered by settingnixpkgs.overlays = lib.mkForce [];.OpenSMTPD has been upgraded to version 6.4.0p1. This release makes backwards-incompatible changes to the configuration file format. See
man smtpd.conffor more information on the new file format.The versioned
postgresqlhave been renamed to use underscore number separators. For example,postgresql96has been renamed topostgresql_9_6.Package
consul-uiand passthroughconsul.uihave been removed. The packageconsulnow uses upstream releases that vendor the UI into the binary. See #48714 for details.Slurm introduces the new option
services.slurm.stateSaveLocation, which is now set to/var/spool/slurmby default (instead of/var/spool). Make sure to move all files to the new directory or to set the option accordingly.The slurmctld now runs as user
slurminstead ofroot. If you want to keep slurmctld running asroot, setservices.slurm.user = root.The options
services.slurm.nodeNameandservices.slurm.partitionNameare now sets of strings to correctly reflect that fact that each of these options can occur more than once in the configuration.The
solrpackage has been upgraded from 4.10.3 to 7.5.0 and has undergone some major changes. Theservices.solrmodule has been updated to reflect these changes. Please review http://lucene.apache.org/solr/ carefully before upgrading.Package
ckbis renamed tockb-next, and optionshardware.ckb.*are renamed tohardware.ckb-next.*.The option
services.xserver.displayManager.job.logToFilewhich was previously set totruewhen using the display managerslightdm,sddmorxprahas been reset to the default value (false).Network interface indiscriminate NixOS firewall options (
networking.firewall.allow*) are now preserved when also setting interface specific rules such asnetworking.firewall.interfaces.en0.allow*. These rules continue to use the pseudo device “default” (networking.firewall.interfaces.default.*), and assigning to this pseudo device will override the (networking.firewall.allow*) options.The
nscdservice now disables all caching ofpasswdandgroupdatabases by default. This was interfering with the correct functioning of thelibnss_systemd.somodule which is used bysystemdto manage uids and usernames in the presence ofDynamicUser=in systemd services. This was already the default behaviour in presence ofservices.sssd.enable = truebecause nscd caching would interfere withsssdin unpredictable ways as well. Because we’re using nscd not for caching, but for convincing glibc to find NSS modules in the nix store instead of an absolute path, we have decided to disable caching globally now, as it’s usually not the behaviour the user wants and can lead to surprising behaviour. Furthermore, negative caching of host lookups is also disabled now by default. This should fix the issue of dns lookups failing in the presence of an unreliable network.If the old behaviour is desired, this can be restored by setting the
services.nscd.configoption with the desired caching parameters.{ services.nscd.config = '' server-user nscd threads 1 paranoia no debug-level 0 enable-cache passwd yes positive-time-to-live passwd 600 negative-time-to-live passwd 20 suggested-size passwd 211 check-files passwd yes persistent passwd no shared passwd yes enable-cache group yes positive-time-to-live group 3600 negative-time-to-live group 60 suggested-size group 211 check-files group yes persistent group no shared group yes enable-cache hosts yes positive-time-to-live hosts 600 negative-time-to-live hosts 5 suggested-size hosts 211 check-files hosts yes persistent hosts no shared hosts yes ''; }See #50316 for details.
GitLab Shell previously used the nix store paths for the
gitlab-shellcommand in itsauthorized_keysfile, which might stop working after garbage collection. To circumvent that, we regenerated that file on each startup. Asgitlab-shellhas now been changed to use/var/run/current-system/sw/bin/gitlab-shell, this is not necessary anymore, but there might be leftover lines with a nix store path. Regenerate theauthorized_keysfile viasudo -u git -H gitlab-rake gitlab:shell:setupin that case.The
pam_unixaccount module is now loaded with its control field set torequiredinstead ofsufficient, so that later PAM account modules that might do more extensive checks are being executed. Previously, the whole account module verification was exited prematurely in case a nss module provided the account name topam_unix. The LDAP and SSSD NixOS modules already add their NSS modules when enabled. In case your setup breaks due to some later PAM account module previously shadowed, or failing NSS lookups, please file a bug. You can get back the old behaviour by manually settingsecurity.pam.services.<name?>.text.The
pam_unixpassword module is now loaded with its control field set tosufficientinstead ofrequired, so that password managed only by later PAM password modules are being executed. Previously, for example, changing an LDAP account’s password through PAM was not possible: the whole password module verification was exited prematurely bypam_unix, preventingpam_ldapto manage the password as it should.fishhas been upgraded to 3.0. It comes with a number of improvements and backwards incompatible changes. See thefishrelease notes for more information.The ibus-table input method has had a change in config format, which causes all previous settings to be lost. See this commit message for details.
NixOS module system type
types.optionSetandlib.mkOptionargumentoptionsare deprecated. Usetypes.submoduleinstead. (#54637)matrix-synapsehas been updated to version 0.99. It will no longer generate a self-signed certificate on first launch and will be the last version to accept self-signed certificates. As such, it is now recommended to use a proper certificate verified by a root CA (for example Let’s Encrypt). The new manual chapter on Matrix contains a working example of using nginx as a reverse proxy in front ofmatrix-synapse, using Let’s Encrypt certificates.mailutilsnow works by default whensendmailis not in a setuid wrapper. As a consequence, thesendmailPathargument, having lost its main use, has been removed.grayloghas been upgraded from version 2.* to 3.*. Some setups making use of extraConfig (especially those exposing Graylog via reverse proxies) need to be updated as upstream removed/replaced some settings. See Upgrading Graylog for details.The option
users.ldap.bind.passwordwas renamed tousers.ldap.bind.passwordFile, and needs to be readable by thenslcduser. Same applies to the newusers.ldap.daemon.rootpwmodpwFileoption.nodejs-6_xis end-of-life.nodejs-6_x,nodejs-slim-6_xandnodePackages_6_xare removed.
Other Notable Changes
The
services.matomomodule gained the optionservices.matomo.packagewhich determines the used Matomo version.The Matomo module now also comes with the systemd service
matomo-archive-processing.serviceand a timer that automatically triggers archive processing every hour. This means that you can safely disable browser triggers for Matomo archiving atAdministration > System > General Settings.Additionally, you can enable to delete old visitor logs at
Administration > System > Privacy, but make sure that you runsystemctl start matomo-archive-processing.serviceat least once without errors if you have already collected data before, so that the reports get archived before the source data gets deleted.composableDerivationalong with supporting library functions has been removed.The deprecated
truecryptpackage has been removed andtruecryptattribute is now an alias forveracrypt. VeraCrypt is backward-compatible with TrueCrypt volumes. Note thatcryptsetupalso supports loading TrueCrypt volumes.The Kubernetes DNS addons, kube-dns, has been replaced with CoreDNS. This change is made in accordance with Kubernetes making CoreDNS the official default starting from Kubernetes v1.11. Please beware that upgrading DNS-addon on existing clusters might induce minor downtime while the DNS-addon terminates and re-initializes. Also note that the DNS-service now runs with 2 pod replicas by default. The desired number of replicas can be configured using:
services.kubernetes.addons.dns.replicas.The quassel-webserver package and module was removed from nixpkgs due to the lack of maintainers.
The manual gained a new chapter on self-hosting
matrix-synapseandriot-web, the most prevalent server and client implementations for the Matrix federated communication network.The astah-community package was removed from nixpkgs due to it being discontinued and the downloads not being available anymore.
The httpd service now saves log files with a .log file extension by default for easier integration with the logrotate service.
The owncloud server packages and httpd subservice module were removed from nixpkgs due to the lack of maintainers.
It is possible now to uze ZRAM devices as general purpose ephemeral block devices, not only as swap. Using more than 1 device as ZRAM swap is no longer recommended, but is still possible by setting
zramSwap.swapDevicesexplicitly.ZRAM algorithm can be changed now.
Changes to ZRAM algorithm are applied during
nixos-rebuild switch, so make sure you have enough swap space on disk to survive ZRAM device rebuild. Alternatively, usenixos-rebuild boot; reboot.Flat volumes are now disabled by default in
hardware.pulseaudio. This has been done to prevent applications, which are unaware of this feature, setting their volumes to 100% on startup causing harm to your audio hardware and potentially your ears.Note
With this change application specific volumes are relative to the master volume which can be adjusted independently, whereas before they were absolute; meaning that in effect, it scaled the device-volume with the volume of the loudest application.
The
ndppdmodule now supports all config options provided by the current upstream version as service options. Additionally thendppdpackage doesn’t contain the systemd unit configuration from upstream anymore, the unit is completely configured by the NixOS module now.New installs of NixOS will default to the Redmine 4.x series unless otherwise specified in
services.redmine.packagewhile existing installs of NixOS will default to the Redmine 3.x series.The Grafana module now supports declarative datasource and dashboard provisioning.
The use of insecure ports on kubernetes has been deprecated. Thus options:
services.kubernetes.apiserver.portandservices.kubernetes.controllerManager.porthas been renamed to.insecurePort, and default of both options has changed to 0 (disabled).Note that the default value of
services.kubernetes.apiserver.bindAddresshas changed from 127.0.0.1 to 0.0.0.0, allowing the apiserver to be accessible from outside the master node itself. If the apiserver insecurePort is enabled, it is strongly recommended to only bind on the loopback interface. See:services.kubernetes.apiserver.insecurebindAddress.The option
services.kubernetes.apiserver.allowPrivilegedandservices.kubernetes.kubelet.allowPrivilegednow defaults to false. Disallowing privileged containers on the cluster.The kubernetes module does no longer add the kubernetes package to
environment.systemPackagesimplicitly.The
inteldriver has been removed from the default list of X.org video drivers. Themodesettingdriver should take over automatically, it is better maintained upstream and has less problems with advanced X11 features. This can lead to a change in the output names used byxrandr. Some performance regressions on some GPU models might happen. Some OpenCL and VA-API applications might also break (Beignet seems to provide OpenCL support withmodesettingdriver, too). Kernel mode setting API does not support backlight control, soxbacklighttool will not work; backlight level can be controlled directly via/sys/or withbrightnessctl. Users who need this functionality more than multi-output XRandR are advised to add `intel` to `videoDrivers` and report an issue (or provide additional details in an existing one)Openmpi has been updated to version 4.0.0, which removes some deprecated MPI-1 symbols. This may break some older applications that still rely on those symbols. An upgrade guide can be found here.
The nginx package now relies on OpenSSL 1.1 and supports TLS 1.3 by default. You can set the protocols used by the nginx service using services.nginx.sslProtocols.
A new subcommand
nixos-rebuild editwas added.
Release 18.09 (“Jellyfish”, 2018/10/05)
Highlights
In addition to numerous new and upgraded packages, this release has the following notable updates:
End of support is planned for end of April 2019, handing over to 19.03.
Platform support: x86_64-linux and x86_64-darwin as always. Support for aarch64-linux is as with the previous releases, not equivalent to the x86-64-linux release, but with efforts to reach parity.
Nix has been updated to 2.1; see its release notes.
Core versions: linux: 4.14 LTS (unchanged), glibc: 2.26 → 2.27, gcc: 7 (unchanged), systemd: 237 → 239.
Desktop version changes: gnome: 3.26 → 3.28, (KDE) plasma-desktop: 5.12 → 5.13.
Notable changes and additions for 18.09 include:
Support for wrapping binaries using
firejailhas been added throughprograms.firejail.wrappedBinaries.For example
{ programs.firejail = { enable = true; wrappedBinaries = { firefox = "${lib.getBin pkgs.firefox}/bin/firefox"; mpv = "${lib.getBin pkgs.mpv}/bin/mpv"; }; }; }This will place
firefoxandmpvbinaries in the global path wrapped by firejail.User channels are now in the default
NIX_PATH, allowing users to use their personalnix-channeldefined channels innix-buildandnix-shellcommands, as well as in imports likeimport <mychannel>.For example
$ nix-channel --add https://channels.nixos.org/nixpkgs-unstable nixpkgsunstable $ nix-channel --update $ nix-build '<nixpkgsunstable>' -A gitFull $ nix run -f '<nixpkgsunstable>' gitFull $ nix-instantiate -E '(import <nixpkgsunstable> {}).gitFull'
New Services
A curated selection of new services that were added since the last release:
The
services.cassandramodule has been reworked and was rewritten from scratch. The service has succeeding tests for the versions 2.1, 2.2, 3.0 and 3.11 of Apache Cassandra.There is a new
services.foundationdbmodule for deploying FoundationDB clusters.When enabled the
iproute2will copy the files expected by ip route (e.g.,rt_tables) in/etc/iproute2. This allows to write aliases for routing tables for instance.services.strongswan-swanctlis a modern replacement forservices.strongswan. You can use either one of them to setup IPsec VPNs but not both at the same time.services.strongswan-swanctluses the swanctl command which uses the modern vici Versatile IKE Configuration Interface. The deprecatedipseccommand used inservices.strongswanis using the legacy stroke configuration interface.The new
services.elasticsearch-curatorservice periodically curates or manages, your Elasticsearch indices and snapshots.
Every new services:
./config/xdg/autostart.nix./config/xdg/icons.nix./config/xdg/menus.nix./config/xdg/mime.nix./hardware/brightnessctl.nix./hardware/onlykey.nix./hardware/video/uvcvideo/default.nix./misc/documentation.nix./programs/firejail.nix./programs/iftop.nix./programs/sedutil.nix./programs/singularity.nix./programs/xss-lock.nix./programs/zsh/zsh-autosuggestions.nix./services/admin/oxidized.nix./services/backup/duplicati.nix./services/backup/restic.nix./services/backup/restic-rest-server.nix./services/cluster/hadoop/default.nix./services/databases/aerospike.nix./services/databases/monetdb.nix./services/desktops/bamf.nix./services/desktops/flatpak.nix./services/desktops/zeitgeist.nix./services/development/bloop.nix./services/development/jupyter/default.nix./services/hardware/lcd.nix./services/hardware/undervolt.nix./services/misc/clipmenu.nix./services/misc/gitweb.nix./services/misc/serviio.nix./services/misc/safeeyes.nix./services/misc/sysprof.nix./services/misc/weechat.nix./services/monitoring/datadog-agent.nix./services/monitoring/incron.nix./services/networking/dnsdist.nix./services/networking/freeradius.nix./services/networking/hans.nix./services/networking/morty.nix./services/networking/ndppd.nix./services/networking/ocserv.nix./services/networking/owamp.nix./services/networking/quagga.nix./services/networking/shadowsocks.nix./services/networking/stubby.nix./services/networking/zeronet.nix./services/security/certmgr.nix./services/security/cfssl.nix./services/security/oauth2_proxy_nginx.nix./services/web-apps/virtlyst.nix./services/web-apps/youtrack.nix./services/web-servers/hitch/default.nix./services/web-servers/hydron.nix./services/web-servers/meguca.nix./services/web-servers/nginx/gitweb.nix./virtualisation/kvmgt.nix./virtualisation/qemu-guest-agent.nix
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
Some licenses that were incorrectly not marked as unfree now are. This is the case for:
cc-by-nc-sa-20: Creative Commons Attribution Non Commercial Share Alike 2.0
cc-by-nc-sa-25: Creative Commons Attribution Non Commercial Share Alike 2.5
cc-by-nc-sa-30: Creative Commons Attribution Non Commercial Share Alike 3.0
cc-by-nc-sa-40: Creative Commons Attribution Non Commercial Share Alike 4.0
cc-by-nd-30: Creative Commons Attribution-No Derivative Works v3.00
msrla: Microsoft Research License Agreement
The deprecated
services.cassandramodule has seen a complete rewrite. (See above.)lib.strictis removed. Usebuiltins.seqinstead.The
clementinepackage points now to the free derivation.clementineFreeis removed now andclementineUnfreepoints to the package which is bundled with the unfreelibspotifypackage.The
netcatpackage is now taken directly from OpenBSD’slibressl, instead of relying on Debian’s fork. The new version should be very close to the old version, but there are some minor differences. Importantly, flags like -b, -q, -C, and -Z are no longer accepted by the nc command.The
services.docker-registry.extraConfigobject doesn’t contain environment variables anymore. Instead it needs to provide an object structure that can be mapped onto the YAML configuration defined in thedocker/distributiondocs.gnucashhas changed from version 2.4 to 3.x. If you’ve been usinggnucash(version 2.4) instead ofgnucash26(version 2.6) you must open your Gnucash data file(s) withgnucash26and then save them to upgrade the file format. Then you may use your data file(s) with Gnucash 3.x. See the upgrade documentation. Gnucash 2.4 is still available under the attributegnucash24.services.mungenow runs as user (and group)mungeinstead of root. Make sure the key file is accessible to the daemon.dockerTools.buildImagenow usesnullas default value fortag, which indicates that the nix output hash will be used as tag.The ELK stack:
elasticsearch,logstashandkibanahas been upgraded from 2.* to 6.3.*. The 2.* versions have been unsupported since last year so they have been removed. You can still use the 5.* versions under the nameselasticsearch5,logstash5andkibana5.The elastic beats:
filebeat,heartbeat,metricbeatandpacketbeathave had the same treatment: they now target 6.3.* as well. The 5.* versions are available under the names:filebeat5,heartbeat5,metricbeat5andpacketbeat5The ELK-6.3 stack now comes with X-Pack by default. Since X-Pack is licensed under the Elastic License the ELK packages now have an unfree license. To use them you need to specify
allowUnfree = true;in your nixpkgs configuration.Fortunately there is also a free variant of the ELK stack without X-Pack. The packages are available under the names:
elasticsearch-oss,logstash-ossandkibana-oss.Options
boot.initrd.luks.devices.name.yubikey.ramfsMountPointboot.initrd.luks.devices.name.yubikey.storage.mountPointwere removed.luksroot.nixmodule never supported more than one YubiKey at a time anyway, hence those options never had any effect. You should be able to remove them from your config without any issues.stdenv.systemandsystemin nixpkgs now refer to the host platform instead of the build platform. For native builds this is not change, let alone a breaking one. For cross builds, it is a breaking change, andstdenv.buildPlatform.systemcan be used instead for the old behavior. They should be using that anyways for clarity.Groups
kvmandrenderare introduced now, as systemd requires them.
Other Notable Changes
dockerTools.pullImagerelies on image digest instead of image tag to download the image. Thesha256of a pulled image has to be updated.lib.attrNamesToStrhas been deprecated. Use more specific concatenation (lib.concat(Map)StringsSep) instead.lib.addErrorContextToAttrshas been deprecated. Usebuiltins.addErrorContextdirectly.lib.showValhas been deprecated. Uselib.traceSeqNinstead.lib.traceXMLValhas been deprecated. Uselib.traceValFn builtins.toXmlinstead.lib.traceXMLValMarkedhas been deprecated. Uselib.traceValFn (x: str + builtins.toXML x)instead.The
pkgsargument to NixOS modules can now be set directly usingnixpkgs.pkgs. Previously, only thesystem,configandoverlaysarguments could be used to influencepkgs.A NixOS system can now be constructed more easily based on a preexisting invocation of Nixpkgs. For example:
{ inherit (pkgs.nixos { boot.loader.grub.enable = false; fileSystems."/".device = "/dev/xvda1"; }) toplevel kernel initialRamdisk manual ; }This benefits evaluation performance, lets you write Nixpkgs packages that depend on NixOS images and is consistent with a deployment architecture that would be centered around Nixpkgs overlays.
lib.traceValIfNothas been deprecated. Useif/then/elseandlib.traceValSeqinstead.lib.traceCallXmlhas been deprecated. Please complain if you use the function regularly.The attribute
lib.nixpkgsVersionhas been deprecated in favor oflib.version. Please refer to the discussion in NixOS/nixpkgs#39416 for further reference.lib.recursiveUpdateUntilwas not acting according to its specification. It has been fixed to act according to the docstring, and a test has been added.The module for
security.dhparamshas two new options now:security.dhparams.statelessPuts the generated Diffie-Hellman parameters into the Nix store instead of managing them in a stateful manner in
/var/lib/dhparams.security.dhparams.defaultBitSizeThe default bit size to use for the generated Diffie-Hellman parameters.
Note
The path to the actual generated parameter files should now be queried using
config.security.dhparams.params.name.pathbecause it might be either in the Nix store or in a directory configured bysecurity.dhparams.path.Note
For developers:
Module implementers should not set a specific bit size in order to let users configure it by themselves if they want to have a different bit size than the default (2048).
An example usage of this would be:
{ config, ... }: { security.dhparams.params.myservice = { }; environment.etc."myservice.conf".text = '' dhparams = ${config.security.dhparams.params.myservice.path} ''; }networking.networkmanager.useDnsmasqhas been deprecated. Usenetworking.networkmanager.dnsinstead.The Kubernetes package has been bumped to major version 1.11. Please consult the release notes for details on new features and api changes.
The option
services.kubernetes.apiserver.admissionControlwas renamed toservices.kubernetes.apiserver.enableAdmissionPlugins.Recommended way to access the Kubernetes Dashboard is via HTTPS (TLS) Therefore; public service port for the dashboard has changed to 443 (container port 8443) and scheme to https.
The option
services.kubernetes.apiserver.addresswas renamed toservices.kubernetes.apiserver.bindAddress. Note that the default value has changed from 127.0.0.1 to 0.0.0.0.The option
services.kubernetes.apiserver.publicAddresswas not used and thus has been removed.The option
services.kubernetes.addons.dashboard.enableRBACwas renamed toservices.kubernetes.addons.dashboard.rbac.enable.The Kubernetes Dashboard now has only minimal RBAC permissions by default. If dashboard cluster-admin rights are desired, set
services.kubernetes.addons.dashboard.rbac.clusterAdminto true. On existing clusters, in order for the revocation of privileges to take effect, the current ClusterRoleBinding for kubernetes-dashboard must be manually removed:kubectl delete clusterrolebinding kubernetes-dashboardThe
programs.screenmodule provides allows to configure/etc/screenrc, however the module behaved fairly counterintuitive as the config exists, but the package wasn’t available. Since 18.09pkgs.screenwill be added toenvironment.systemPackages.The module
services.networking.hostapdnow uses WPA2 by default.s6Dns,s6Networking,s6LinuxUtilsands6PortableUtilsrenamed tos6-dns,s6-networking,s6-linux-utilsands6-portable-utilsrespectively.The module option
nix.useSandboxis now defaulted totrue.The config activation script of
nixos-rebuildnow reloads all user units for each authenticated user.The default display manager is now LightDM. To use SLiM set
services.xserver.displayManager.slim.enabletotrue.NixOS option descriptions are now automatically broken up into individual paragraphs if the text contains two consecutive newlines, so it’s no longer necessary to use
</para><para>to start a new paragraph.Top-level
buildPlatform,hostPlatform, andtargetPlatformin Nixpkgs are deprecated. Please use their equivalents instdenvinstead:stdenv.buildPlatform,stdenv.hostPlatform, andstdenv.targetPlatform.
Release 18.03 (“Impala”, 2018/04/04)
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
End of support is planned for end of October 2018, handing over to 18.09.
Platform support: x86_64-linux and x86_64-darwin since release time (the latter isn’t NixOS, really). Binaries for aarch64-linux are available, but no channel exists yet, as it’s waiting for some test fixes, etc.
Nix now defaults to 2.0; see its release notes.
Core version changes: linux: 4.9 -> 4.14, glibc: 2.25 -> 2.26, gcc: 6 -> 7, systemd: 234 -> 237.
Desktop version changes: gnome: 3.24 -> 3.26, (KDE) plasma-desktop: 5.10 -> 5.12.
MariaDB 10.2, updated from 10.1, is now the default MySQL implementation. While upgrading a few changes have been made to the infrastructure involved:
libmysqlhas been deprecated, please usemysql.connector-cinstead, a compatibility passthru has been added to the MySQL packages.The
mysql57package has a newstaticoutput containing the static libraries includinglibmysqld.a
PHP now defaults to PHP 7.2, updated from 7.1.
New Services
The following new services were added since the last release:
./config/krb5/default.nix./hardware/digitalbitbox.nix./misc/label.nix./programs/ccache.nix./programs/criu.nix./programs/digitalbitbox/default.nix./programs/less.nix./programs/npm.nix./programs/plotinus.nix./programs/rootston.nix./programs/systemtap.nix./programs/sway.nix./programs/udevil.nix./programs/way-cooler.nix./programs/yabar.nix./programs/zsh/zsh-autoenv.nix./services/backup/borgbackup.nix./services/backup/crashplan-small-business.nix./services/desktops/dleyna-renderer.nix./services/desktops/dleyna-server.nix./services/desktops/pipewire.nix./services/desktops/gnome3/chrome-gnome-shell.nix./services/desktops/gnome3/tracker-miners.nix./services/hardware/fwupd.nix./services/hardware/interception-tools.nix./services/hardware/u2f.nix./services/hardware/usbmuxd.nix./services/mail/clamsmtp.nix./services/mail/dkimproxy-out.nix./services/mail/pfix-srsd.nix./services/misc/gitea.nix./services/misc/home-assistant.nix./services/misc/ihaskell.nix./services/misc/logkeys.nix./services/misc/novacomd.nix./services/misc/osrm.nix./services/misc/plexpy.nix./services/misc/pykms.nix./services/misc/tzupdate.nix./services/monitoring/fusion-inventory.nix./services/monitoring/prometheus/exporters.nix./services/network-filesystems/beegfs.nix./services/network-filesystems/davfs2.nix./services/network-filesystems/openafs/client.nix./services/network-filesystems/openafs/server.nix./services/network-filesystems/ceph.nix./services/networking/aria2.nix./services/networking/monero.nix./services/networking/nghttpx/default.nix./services/networking/nixops-dns.nix./services/networking/rxe.nix./services/networking/stunnel.nix./services/web-apps/matomo.nix./services/web-apps/restya-board.nix./services/web-servers/mighttpd2.nix./services/x11/fractalart.nix./system/boot/binfmt.nix./system/boot/grow-partition.nix./tasks/filesystems/ecryptfs.nix./virtualisation/hyperv-guest.nix
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
sound.enablenow defaults to false.Dollar signs in options under
services.postfixare passed verbatim to Postfix, which will interpret them as the beginning of a parameter expression. This was already true for string-valued options in the previous release, but not for list-valued options. If you need to pass literal dollar signs through Postfix, double them.The
postagepackage (for web-based PostgreSQL administration) has been renamed topgmanage. The corresponding module has also been renamed. To migrate please rename allservices.postageoptions toservices.pgmanage.Package attributes starting with a digit have been prefixed with an underscore sign. This is to avoid quoting in the configuration and other issues with command-line tools like
nix-env. The change affects the following packages:2048-in-terminal→_2048-in-terminal90secondportraits→_90secondportraits2bwm→_2bwm389-ds-base→_389-ds-base
The OpenSSH service no longer enables support for DSA keys by default, which could cause a system lock out. Update your keys or, unfavorably, re-enable DSA support manually.
DSA support was deprecated in OpenSSH 7.0, due to it being too weak. To re-enable support, add
PubkeyAcceptedKeyTypes +ssh-dssto the end of yourservices.openssh.extraConfig.After updating the keys to be stronger, anyone still on a pre-17.03 version is safe to jump to 17.03, as vetted here.
The
opensshpackage now includes Kerberos support by default; theopenssh_with_kerberospackage is now a deprecated alias. If you do not want Kerberos support, you can doopenssh.override { withKerberos = false; }. Note, this also applies to theopenssh_hpnpackage.cc-wrapperhas been split in two; there is now also abintools-wrapper. The most commonly used files innix-supportare now split between the two wrappers. Some commonly used ones, likenix-support/dynamic-linker, are duplicated for backwards compatibility, even though they rightly belong only inbintools-wrapper. Other more obscure ones are just moved.The propagation logic has been changed. The new logic, along with new types of dependencies that go with, is thoroughly documented in the “Specifying dependencies” section of the “Standard Environment” chapter of the nixpkgs manual. The old logic isn’t but is easy to describe: dependencies were propagated as the same type of dependency no matter what. In practice, that means that many
propagatedNativeBuildInputsshould instead bepropagatedBuildInputs. Thankfully, that was and is the least used type of dependency. Also, it means that somepropagatedBuildInputsshould instead bedepsTargetTargetPropagated. Other types dependencies should be unaffected.lib.addPassthru drv passthruis removed. Uselib.extendDerivation true passthru drvinstead.The
memcachedservice no longer accept dynamic socket paths viaservices.memcached.socket. Unix sockets can be still enabled byservices.memcached.enableUnixSocketand will be accessible at/run/memcached/memcached.sock.The
hardware.amdHybridGraphics.disableoption was removed for lack of a maintainer. If you still need this module, you may wish to include a copy of it from an older version of nixos in your imports.The merging of config options for
services.postfix.configwas buggy. Previously, if other options in the Postfix module likeservices.postfix.useSrswere set and the user set config options that were also set by such options, the resulting config wouldn’t include all options that were needed. They are now merged correctly. If config options need to be overridden,lib.mkForceorlib.mkOverridecan be used.The following changes apply if the
stateVersionis changed to 18.03 or higher. ForstateVersion = "17.09"or lower the old behavior is preserved.matrix-synapseuses postgresql by default instead of sqlite. Migration instructions can be found here .
The
jidpackage has been removed, due to maintenance overhead of a go package having non-versioned dependencies.When using
services.xserver.libinput(enabled by default in GNOME), it now handles all input devices, not just touchpads. As a result, you might need to re-evaluate any custom Xorg configuration. In particular,Option "XkbRules" "base"may result in broken keyboard layout.The
atticpackage was removed. A maintained fork called Borg should be used instead. Migration instructions can be found here.The Piwik analytics software was renamed to Matomo:
The package
pkgs.piwikwas renamed topkgs.matomo.The service
services.piwikwas renamed toservices.matomo.The data directory
/var/lib/piwikwas renamed to/var/lib/matomo. All files will be moved automatically on first startup, but you might need to adjust your backup scripts.The default
serverNamefor the nginx configuration changed frompiwik.${config.networking.hostName}tomatomo.${config.networking.hostName}.${config.networking.domain}ifconfig.networking.domainis set,matomo.${config.networking.hostName}if it is not set. If you change yourserverName, remember you’ll need to update thetrustedHosts[]array in/var/lib/matomo/config/config.ini.phpas well.The
piwikuser was renamed tomatomo. The service will adjust ownership automatically for files in the data directory. If you use unix socket authentication, remember to give the newmatomouser access to the database and to change theusernametomatomoin the[database]section of/var/lib/matomo/config/config.ini.php.If you named your database `piwik`, you might want to rename it to `matomo` to keep things clean, but this is neither enforced nor required.
nodejs-4_xis end-of-life.nodejs-4_x,nodejs-slim-4_xandnodePackages_4_xare removed.The
pump.ioNixOS module was removed. It is now maintained as an external module.The Prosody XMPP server has received a major update. The following modules were renamed:
services.prosody.modules.httpserveris nowservices.prosody.modules.http_filesservices.prosody.modules.consoleis nowservices.prosody.modules.admin_telnet
Many new modules are now core modules, most notably
services.prosody.modules.carbonsandservices.prosody.modules.mam.The better-performing
libeventbackend is now enabled by default.withCommunityModulesnow passes through the modules toservices.prosody.extraModules. UsewithOnlyInstalledCommunityModulesfor modules that should not be enabled directly, e.glib_ldap.All prometheus exporter modules are now defined as submodules. The exporters are configured using
services.prometheus.exporters.
Other Notable Changes
ZNC option
services.znc.mutablenow defaults totrue. That means that old configuration is not overwritten by default when update to the znc options are made.The option
networking.wireless.networks.<name>.authhas been added for wireless networks with WPA-Enterprise authentication. There is also a newextraConfigoption to directly configurewpa_supplicantandhiddento connect to hidden networks.In the module
networking.interfaces.<name>the following options have been removed:ipAddressipv6AddressprefixLengthipv6PrefixLengthsubnetMask
To assign static addresses to an interface the options
ipv4.addressesandipv6.addressesshould be used instead. The optionsip4andip6have been renamed toipv4.addressesipv6.addressesrespectively. The new optionsipv4.routesandipv6.routeshave been added to set up static routing.The option
services.logstash.listenAddressis now127.0.0.1by default. Previously the default behaviour was to listen on all interfaces.services.btrfs.autoScrubhas been added, to periodically check btrfs filesystems for data corruption. If there’s a correct copy available, it will automatically repair corrupted blocks.displayManager.lightdm.greeters.gtk.clock-format.has been added, the clock format string (as expected by strftime, e.g.%H:%M) to use with the lightdm gtk greeter panel.If set to null the default clock format is used.
displayManager.lightdm.greeters.gtk.indicatorshas been added, a list of allowed indicator modules to use with the lightdm gtk greeter panel.Built-in indicators include
~a11y,~language,~session,~power,~clock,~host,~spacer. Unity indicators can be represented by short name (e.g.sound,power), service file name, or absolute path.If set to
nullthe default indicators are used.In order to have the previous default configuration add
{ services.xserver.displayManager.lightdm.greeters.gtk.indicators = [ "~host" "~spacer" "~clock" "~spacer" "~session" "~language" "~a11y" "~power" ]; }to your
configuration.nix.The NixOS test driver supports user services declared by
systemd.user.services. The methodswaitForUnit,getUnitInfo,startJobandstopJobprovide an optional$userargument for that purpose.Enabling bash completion on NixOS,
programs.bash.enableCompletion, will now also enable completion for the Nix command line tools by installing the nix-bash-completions package.The vim/kakoune plugin updater now reads from a CSV file: check
pkgs/applications/editors/vim/plugins/vim-plugin-namesout to see the new format
Release 17.09 (“Hummingbird”, 2017/09/??)
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
The GNOME version is now 3.24. KDE Plasma was upgraded to 5.10, KDE Applications to 17.08.1 and KDE Frameworks to 5.37.
The user handling now keeps track of deallocated UIDs/GIDs. When a user or group is revived, this allows it to be allocated the UID/GID it had before. A consequence is that UIDs and GIDs are no longer reused.
The module option
services.xserver.xrandrHeadsnow causes the first head specified in this list to be set as the primary head. Apart from that, it’s now possible to also set additional options by using an attribute set, for example:{ services.xserver.xrandrHeads = [ "HDMI-0" { output = "DVI-0"; primary = true; monitorConfig = '' Option "Rotate" "right" ''; } ]; }This will set the
DVI-0output to be the primary head, even thoughHDMI-0is the first head in the list.The handling of SSL in the
services.nginxmodule has been cleaned up, renaming the misnamedenableSSLtoonlySSLwhich reflects its original intention. This is not to be used with the already existingforceSSLwhich creates a second non-SSL virtual host redirecting to the SSL virtual host. This by chance had worked earlier due to specific implementation details. In case you had specified both please remove theenableSSLoption to keep the previous behaviour.Another
addSSLoption has been introduced to configure both a non-SSL virtual host and an SSL virtual host with the same configuration.Options to configure
resolveroptions andupstreamblocks have been introduced. See their information for further details.The
portoption has been replaced by a more genericlistenoption which makes it possible to specify multiple addresses, ports and SSL configs dependent on the new SSL handling mentioned above.
New Services
The following new services were added since the last release:
config/fonts/fontconfig-penultimate.nixconfig/fonts/fontconfig-ultimate.nixconfig/terminfo.nixhardware/sensor/iio.nixhardware/nitrokey.nixhardware/raid/hpsa.nixprograms/browserpass.nixprograms/gnupg.nixprograms/qt5ct.nixprograms/slock.nixprograms/thefuck.nixsecurity/auditd.nixsecurity/lock-kernel-modules.nixservice-managers/docker.nixservice-managers/trivial.nixservices/admin/salt/master.nixservices/admin/salt/minion.nixservices/audio/slimserver.nixservices/cluster/kubernetes/default.nixservices/cluster/kubernetes/dns.nixservices/cluster/kubernetes/dashboard.nixservices/continuous-integration/hail.nixservices/databases/clickhouse.nixservices/databases/postage.nixservices/desktops/gnome3/gnome-disks.nixservices/desktops/gnome3/gpaste.nixservices/logging/SystemdJournal2Gelf.nixservices/logging/heartbeat.nixservices/logging/journalwatch.nixservices/logging/syslogd.nixservices/mail/mailhog.nixservices/mail/nullmailer.nixservices/misc/airsonic.nixservices/misc/autorandr.nixservices/misc/exhibitor.nixservices/misc/fstrim.nixservices/misc/gollum.nixservices/misc/irkerd.nixservices/misc/jackett.nixservices/misc/radarr.nixservices/misc/snapper.nixservices/monitoring/osquery.nixservices/monitoring/prometheus/collectd-exporter.nixservices/monitoring/prometheus/fritzbox-exporter.nixservices/network-filesystems/kbfs.nixservices/networking/dnscache.nixservices/networking/fireqos.nixservices/networking/iwd.nixservices/networking/keepalived/default.nixservices/networking/keybase.nixservices/networking/lldpd.nixservices/networking/matterbridge.nixservices/networking/squid.nixservices/networking/tinydns.nixservices/networking/xrdp.nixservices/security/shibboleth-sp.nixservices/security/sks.nixservices/security/sshguard.nixservices/security/torify.nixservices/security/usbguard.nixservices/security/vault.nixservices/system/earlyoom.nixservices/system/saslauthd.nixservices/web-apps/nexus.nixservices/web-apps/pgpkeyserver-lite.nixservices/web-apps/piwik.nixservices/web-servers/lighttpd/collectd.nixservices/web-servers/minio.nixservices/x11/display-managers/xpra.nixservices/x11/xautolock.nixtasks/filesystems/bcachefs.nixtasks/powertop.nix
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
In an Qemu-based virtualization environment, the network interface names changed from i.e.
enp0s3toens3.This is due to a kernel configuration change. The new naming is consistent with those of other Linux distributions with systemd. See #29197 for more information.
A machine is affected if the
virt-whattool either returnsqemuorkvmand has interface names used in any part of its NixOS configuration, in particular if a static network configuration withnetworking.interfacesis used.Before rebooting affected machines, please ensure:
Change the interface names in your NixOS configuration. The first interface will be called
ens3, the second oneens8and starting from there incremented by 1.After changing the interface names, rebuild your system with
nixos-rebuild bootto activate the new configuration after a reboot. If you switch to the new configuration right away you might lose network connectivity! If usingnixops, deploy withnixops deploy --force-reboot.
The following changes apply if the
stateVersionis changed to 17.09 or higher. ForstateVersion = "17.03"or lower the old behavior is preserved.The
postgresdefault version was changed from 9.5 to 9.6.The
postgressuperuser name has changed fromroottopostgresto more closely follow what other Linux distributions are doing.The
postgresdefaultdataDirhas changed from/var/db/postgresto/var/lib/postgresql/$psqlSchemawhere $psqlSchema is 9.6 for example.The
mysqldefaultdataDirhas changed from/var/mysqlto/var/lib/mysql.Radicale’s default package has changed from 1.x to 2.x. Instructions to migrate can be found here . It is also possible to use the newer version by setting the
packagetoradicale2, which is done automatically whenstateVersionis 17.09 or higher. TheextraArgsoption has been added to allow passing the data migration arguments specified in the instructions; see theradicale.nixNixOS test for an example migration.
The
aiccupackage was removed. This is due to SixXS sunsetting its IPv6 tunnel.The
fanctlpackage andfanmodule have been removed due to the developers not upstreaming their iproute2 patches and lagging with compatibility to recent iproute2 versions.Top-level
ideapackage collection was renamed. All JetBrains IDEs are now atjetbrains.flexget’s state database cannot be upgraded to its new internal format, requiring removal of any existingdb-config.sqlitewhich will be automatically recreated.The
ipfsservice now doesn’t ignore thedataDiroption anymore. If you’ve ever set this option to anything other than the default you’ll have to either unset it (so the default gets used) or migrate the old data manually withdataDir=<valueOfDataDir> mv /var/lib/ipfs/.ipfs/* $dataDir rmdir /var/lib/ipfs/.ipfsThe
caddyservice was previously using an extra.caddydirectory in the data directory specified with thedataDiroption. The contents of the.caddydirectory are now expected to be in thedataDir.The
ssh-agentuser service is not started by default anymore. Useprograms.ssh.startAgentto enable it if needed. There is also a newprograms.gnupg.agentmodule that creates agpg-agentuser service. It can also serve as a SSH agent ifenableSSHSupportis set.The
services.tinc.networks.<name>.listenAddressoption had a misleading name that did not correspond to its behavior. It now correctly defines the ip to listen for incoming connections on. To keep the previous behaviour, useservices.tinc.networks.<name>.bindToAddressinstead. Refer to the description of the options for more details.tlsdatepackage and module were removed. This is due to the project being dead and not building with openssl 1.1.wvdialpackage and module were removed. This is due to the project being dead and not building with openssl 1.1.cc-wrapper’s setup-hook now exports a number of environment variables corresponding to binutils binaries, (e.g.LD,STRIP,RANLIB, etc). This is done to prevent packages’ build systems guessing, which is harder to predict, especially when cross-compiling. However, some packages have broken due to this—their build systems either not supporting, or claiming to support without adequate testing, taking such environment variables as parameters.services.firefox.syncservernow runs by default as a non-root user. To accommodate this change, the default sqlite database location has also been changed. Migration should work automatically. Refer to the description of the options for more details.The
compizwindow manager and package was removed. The system support had been broken for several years.Touchpad support should now be enabled through
libinputassynapticsis now deprecated. See the optionservices.xserver.libinput.enable.grsecurity/PaX support has been dropped, following upstream’s decision to cease free support. See upstream’s announcement for more information. No complete replacement for grsecurity/PaX is available presently.
services.mysqlnow has declarative configuration of databases and users with theensureDatabasesandensureUsersoptions.These options will never delete existing databases and users, especially not when the value of the options are changed.
The MySQL users will be identified using Unix socket authentication. This authenticates the Unix user with the same name only, and that without the need for a password.
If you have previously created a MySQL
rootuser with a password, you will need to addrootuser for unix socket authentication before using the new options. This can be done by running the following SQL script:CREATE USER 'root'@'%' IDENTIFIED BY ''; GRANT ALL PRIVILEGES ON *.* TO 'root'@'%' WITH GRANT OPTION; FLUSH PRIVILEGES; -- Optionally, delete the password-authenticated user: -- DROP USER 'root'@'localhost';services.mysqlBackupnow works by default without any user setup, including for users other thanmysql.By default, the
mysqluser is no longer the user which performs the backup. Instead a system accountmysqlbackupis used.The
mysqlBackupservice is also now using systemd timers instead ofcron.Therefore, the
services.mysqlBackup.periodoption no longer exists, and has been replaced withservices.mysqlBackup.calendar, which is in the format of systemd.time(7).If you expect to be sent an e-mail when the backup fails, consider using a script which monitors the systemd journal for errors. Regretfully, at present there is no built-in functionality for this.
You can check that backups still work by running
systemctl start mysql-backupthensystemctl status mysql-backup.Templated systemd services e.g
container@nameare now handled correctly when switching to a new configuration, resulting in them being reloaded.Steam: the
newStdcppparameter was removed and should not be needed anymore.Redis has been updated to version 4 which mandates a cluster mass-restart, due to changes in the network handling, in order to ensure compatibility with networks NATing traffic.
Other Notable Changes
Modules can now be disabled by using disabledModules, allowing another to take it’s place. This can be used to import a set of modules from another channel while keeping the rest of the system on a stable release.
Updated to FreeType 2.7.1, including a new TrueType engine. The new engine replaces the Infinality engine which was the default in NixOS. The default font rendering settings are now provided by fontconfig-penultimate, replacing fontconfig-ultimate; the new defaults are less invasive and provide rendering that is more consistent with other systems and hopefully with each font designer’s intent. Some system-wide configuration has been removed from the Fontconfig NixOS module where user Fontconfig settings are available.
ZFS/SPL have been updated to 0.7.0,
zfsUnstable, splUnstablehave therefore been removed.The
time.timeZoneoption now allows the valuenullin addition to timezone strings. This value allows changing the timezone of a system imperatively usingtimedatectl set-timezone. The default timezone is still UTC.Nixpkgs overlays may now be specified with a file as well as a directory. The value of
<nixpkgs-overlays>may be a file, and~/.config/nixpkgs/overlays.nixcan be used instead of the~/.config/nixpkgs/overlaysdirectory.See the overlays chapter of the Nixpkgs manual for more details.
Definitions for
/etc/hostscan now be specified declaratively withnetworking.hosts.Two new options have been added to the installer loader, in addition to the default having changed. The kernel log verbosity has been lowered to the upstream default for the default options, in order to not spam the console when e.g. joining a network.
This therefore leads to adding a new
debugoption to set the log level to the previous verbose mode, to make debugging easier, but still accessible easily.Additionally a
copytoramoption has been added, which makes it possible to remove the install medium after booting. This allows tethering from your phone after booting from it.services.gitlab-runner.configOptionshas been added to specify the configuration of gitlab-runners declaratively.services.jenkins.pluginshas been added to install plugins easily, this can be generated with jenkinsPlugins2nix.services.postfix.confighas been added to specify the main.cf with NixOS options. Additionally other options have been added to the postfix module and has been improved further.The GitLab package and module have been updated to the latest 10.0 release.
The
systemd-bootboot loader now lists the NixOS version, kernel version and build date of all bootable generations.The dnscrypt-proxy service now defaults to using a random upstream resolver, selected from the list of public non-logging resolvers with DNSSEC support. Existing configurations can be migrated to this mode of operation by omitting the
services.dnscrypt-proxy.resolverNameoption or setting it to"random".
Release 17.03 (“Gorilla”, 2017/03/31)
Highlights
In addition to numerous new and upgraded packages, this release has the following highlights:
Nixpkgs is now extensible through overlays. See the Nixpkgs manual for more information.
This release is based on Glibc 2.25, GCC 5.4.0 and systemd 232. The default Linux kernel is 4.9 and Nix is at 1.11.8.
The default desktop environment now is KDE’s Plasma 5. KDE 4 has been removed
The setuid wrapper functionality now supports setting capabilities.
X.org server uses branch 1.19. Due to ABI incompatibilities,
ati_unfreekeeps forcing 1.17 andamdgpu-prostarts forcing 1.18.Cross compilation has been rewritten. See the nixpkgs manual for details. The most obvious breaking change is that in derivations there is no
.nativeDrvnor.crossDrvare now cross by default, not native.The
overridePackagesfunction has been rewritten to be replaced by overlaysPackages in nixpkgs can be marked as insecure through listed vulnerabilities. See the Nixpkgs manual for more information.
PHP now defaults to PHP 7.1
New Services
The following new services were added since the last release:
hardware/ckb.nixhardware/mcelog.nixhardware/usb-wwan.nixhardware/video/capture/mwprocapture.nixprograms/adb.nixprograms/chromium.nixprograms/gphoto2.nixprograms/java.nixprograms/mtr.nixprograms/oblogout.nixprograms/vim.nixprograms/wireshark.nixsecurity/dhparams.nixservices/audio/ympd.nixservices/computing/boinc/client.nixservices/continuous-integration/buildbot/master.nixservices/continuous-integration/buildbot/worker.nixservices/continuous-integration/gitlab-runner.nixservices/databases/riak-cs.nixservices/databases/stanchion.nixservices/desktops/gnome3/gnome-terminal-server.nixservices/editors/infinoted.nixservices/hardware/illum.nixservices/hardware/trezord.nixservices/logging/journalbeat.nixservices/mail/offlineimap.nixservices/mail/postgrey.nixservices/misc/couchpotato.nixservices/misc/docker-registry.nixservices/misc/errbot.nixservices/misc/geoip-updater.nixservices/misc/gogs.nixservices/misc/leaps.nixservices/misc/nix-optimise.nixservices/misc/ssm-agent.nixservices/misc/sssd.nixservices/monitoring/arbtt.nixservices/monitoring/netdata.nixservices/monitoring/prometheus/default.nixservices/monitoring/prometheus/alertmanager.nixservices/monitoring/prometheus/blackbox-exporter.nixservices/monitoring/prometheus/json-exporter.nixservices/monitoring/prometheus/nginx-exporter.nixservices/monitoring/prometheus/node-exporter.nixservices/monitoring/prometheus/snmp-exporter.nixservices/monitoring/prometheus/unifi-exporter.nixservices/monitoring/prometheus/varnish-exporter.nixservices/monitoring/sysstat.nixservices/monitoring/telegraf.nixservices/monitoring/vnstat.nixservices/network-filesystems/cachefilesd.nixservices/network-filesystems/glusterfs.nixservices/network-filesystems/ipfs.nixservices/networking/dante.nixservices/networking/dnscrypt-wrapper.nixservices/networking/fakeroute.nixservices/networking/flannel.nixservices/networking/htpdate.nixservices/networking/miredo.nixservices/networking/nftables.nixservices/networking/powerdns.nixservices/networking/pdns-recursor.nixservices/networking/quagga.nixservices/networking/redsocks.nixservices/networking/wireguard.nixservices/system/cgmanager.nixservices/torrent/opentracker.nixservices/web-apps/atlassian/confluence.nixservices/web-apps/atlassian/crowd.nixservices/web-apps/atlassian/jira.nixservices/web-apps/frab.nixservices/web-apps/nixbot.nixservices/web-apps/selfoss.nixservices/web-apps/quassel-webserver.nixservices/x11/unclutter-xfixes.nixservices/x11/urxvtd.nixsystem/boot/systemd-nspawn.nixvirtualisation/ecs-agent.nixvirtualisation/lxcfs.nixvirtualisation/openstack/keystone.nixvirtualisation/openstack/glance.nix
Backward Incompatibilities
When upgrading from a previous release, please be aware of the following incompatible changes:
Derivations have no
.nativeDrvnor.crossDrvand are now cross by default, not native.stdenv.overridesis now expected to takeselfandsuperarguments. Seelib.trivial.extendsfor what those parameters represent.ansiblenow defaults to ansible version 2 as version 1 has been removed due to a serious vulnerability unpatched by upstream.gnomealias has been removed along withgtk,gtkmmand several others. Now you need to use versioned attributes, likegnome3.The attribute name of the Radicale daemon has been changed from
pythonPackages.radicaletoradicale.The
stripHashbash function instdenvchanged according to its documentation; it now outputs the stripped name tostdoutinstead of putting it in the variablestrippedName.PHP now scans for extra configuration .ini files in /etc/php.d instead of /etc. This prevents accidentally loading non-PHP .ini files that may be in /etc.
Two lone top-level dict dbs moved into
dictdDBs. This affects:dictdWordnetwhich is now atdictdDBs.wordnetanddictdWiktionarywhich is now atdictdDBs.wiktionaryParsoid service now uses YAML configuration format.
service.parsoid.interwikisis now calledservice.parsoid.wikisand is a list of either API URLs or attribute sets as specified in parsoid’s documentation.Ntpdwas replaced bysystemd-timesyncdas the default service to synchronize system time with a remote NTP server. The old behavior can be restored by settingservices.ntp.enabletotrue. Upstream time servers for all NTP implementations are now configured usingnetworking.timeServers.service.nylonis now declared using named instances. As an example:{ services.nylon = { enable = true; acceptInterface = "br0"; bindInterface = "tun1"; port = 5912; }; }should be replaced with:
{ services.nylon.myvpn = { enable = true; acceptInterface = "br0"; bindInterface = "tun1"; port = 5912; }; }this enables you to declare a SOCKS proxy for each uplink.
overridePackagesfunction no longer exists. It is replaced by overlays. For example, the following code:let pkgs = import <nixpkgs> { }; in pkgs.overridePackages ( self: super: { # ... } )should be replaced by:
let pkgs = import <nixpkgs> { }; in import pkgs.path { overlays = [ (self: super: { # ... }) ]; }Autoloading connection tracking helpers is now disabled by default. This default was also changed in the Linux kernel and is considered insecure if not configured properly in your firewall. If you need connection tracking helpers (i.e. for active FTP) please enable
networking.firewall.autoLoadConntrackHelpersand tunenetworking.firewall.connectionTrackingModulesto suit your needs.local_recipient_mapsis not set to empty value by Postfix service. It’s an insecure default as stated by Postfix documentation. Those who want to retain this setting need to set it viaservices.postfix.extraConfig.Iputils no longer provide ping6 and traceroute6. The functionality of these tools has been integrated into ping and traceroute respectively. To enforce an address family the new flags
-4and-6have been added. One notable incompatibility is that specifying an interface (for link-local IPv6 for instance) is no longer done with the-Iflag, but by encoding the interface into the address (ping fe80::1%eth0).The socket handling of the
services.rmiltermodule has been fixed and refactored. As rmilter doesn’t support binding to more than one socket, the optionsbindUnixSocketsandbindInetSocketshave been replaced byservices.rmilter.bindSocket.*. The default is still a unix socket in/run/rmilter/rmilter.sock. Refer to the options documentation for more information.The
fetch*functions no longer support md5, please use sha256 instead.The dnscrypt-proxy module interface has been streamlined around the
extraArgsoption. Where possible, legacy option declarations are mapped toextraArgsbut will emit warnings. TheresolverListhas been outright removed: to use an unlisted resolver, use thecustomResolveroption.torbrowser now stores local state under
~/.local/share/tor-browserby default. Any browser profile data from the old location,~/.torbrowser4, must be migrated manually.The ihaskell, monetdb, offlineimap and sitecopy services have been removed.
Other Notable Changes
Module type system have a new extensible option types feature that allow to extend certain types, such as enum, through multiple option declarations of the same option across multiple modules.
jrenow defaults to GTK UI by default. This improves visual consistency and makes Java follow system font style, improving the situation on HighDPI displays. This has a cost of increased closure size; for server and other headless workloads it’s recommended to usejre_headless.Python 2.6 interpreter and package set have been removed.
The Python 2.7 interpreter does not use modules anymore. Instead, all CPython interpreters now include the whole standard library except for `tkinter`, which is available in the Python package set.
Python 2.7, 3.5 and 3.6 are now built deterministically and 3.4 mostly. Minor modifications had to be made to the interpreters in order to generate deterministic bytecode. This has security implications and is relevant for those using Python in a
nix-shell. See the Nixpkgs manual for details.The Python package sets now use a fixed-point combinator and the sets are available as attributes of the interpreters.
The Python function
buildPythonPackagehas been improved and can be used to build from Setuptools source, Flit source, and precompiled Wheels.When adding new or updating current Python libraries, the expressions should be put in separate files in
pkgs/development/python-modulesand called frompython-packages.nix.The dnscrypt-proxy service supports synchronizing the list of public resolvers without working DNS resolution. This fixes issues caused by the resolver list becoming outdated. It also improves the viability of DNSCrypt only configurations.
Containers using bridged networking no longer lose their connection after changes to the host networking.
ZFS supports pool auto scrubbing.
The bind DNS utilities (e.g. dig) have been split into their own output and are now also available in
pkgs.dnsutilsand it is no longer necessary to pull in all ofbindto use them.Per-user configuration was moved from
~/.nixpkgsto~/.config/nixpkgs. The former is still valid forconfig.nixfor backwards compatibility.
Release 16.09 (“Flounder”, 2016/09/30)
In addition to numerous new and upgraded packages, this release has the following highlights:
Many NixOS configurations and Nix packages now use significantly less disk space, thanks to the extensive work on closure size reduction. For example, the closure size of a minimal NixOS container went down from ~424 MiB in 16.03 to ~212 MiB in 16.09, while the closure size of Firefox went from ~651 MiB to ~259 MiB.
To improve security, packages are now built using various hardening features. See the Nixpkgs manual for more information.
Support for PXE netboot. See the section called “Booting from the “netboot” media (PXE)” for documentation.
X.org server 1.18. If you use the
ati_unfreedriver, 1.17 is still used due to an ABI incompatibility.This release is based on Glibc 2.24, GCC 5.4.0 and systemd 231. The default Linux kernel remains 4.4.
The following new services were added since the last release:
(this will get automatically generated at release time)
When upgrading from a previous release, please be aware of the following incompatible changes:
A large number of packages have been converted to use the multiple outputs feature of Nix to greatly reduce the amount of required disk space, as mentioned above. This may require changes to any custom packages to make them build again; see the relevant chapter in the Nixpkgs manual for more information. (Additional caveat to packagers: some packaging conventions related to multiple-output packages were changed late (August 2016) in the release cycle and differ from the initial introduction of multiple outputs.)
Previous versions of Nixpkgs had support for all versions of the LTS Haskell package set. That support has been dropped. The previously provided
haskell.packages.lts-x_ypackage sets still exist in name to avoid breaking user code, but these package sets don’t actually contain the versions mandated by the corresponding LTS release. Instead, our package set it loosely based on the latest available LTS release, i.e. LTS 7.x at the time of this writing. New releases of NixOS and Nixpkgs will drop those old names entirely. The motivation for this change has been discussed at length on thenix-devmailing list and in Github issue #14897. Development strategies for Haskell hackers who want to rely on Nix and NixOS have been described in another nix-dev article.Shell aliases for systemd sub-commands were dropped:
start,stop,restart,status.Redis now binds to 127.0.0.1 only instead of listening to all network interfaces. This is the default behavior of Redis 3.2
/var/emptyis now immutable. Activation script runschattr +ito forbid any modifications inside the folder. See the pull request for what bugs this caused.Gitlab’s maintenance script
gitlab-runnerwas removed and split up into the more clearergitlab-runandgitlab-rakescripts, becausegitlab-runneris a component of Gitlab CI.services.xserver.libinput.accelProfiledefault changed fromflattoadaptive, as per official documentation.fonts.fontconfig.ultimate.renderingwas removed because our presets were obsolete for some time. New presets are hardcoded into FreeType; you can select a preset viafonts.fontconfig.ultimate.preset. You can customize those presets via ordinary environment variables, usingenvironment.variables.The
auditservice is no longer enabled by default. Usesecurity.audit.enable = trueto explicitly enable it.pkgs.linuxPackages.virtualboxnow contains only the kernel modules instead of the VirtualBox user space binaries. If you want to reference the user space binaries, you have to use the newpkgs.virtualboxinstead.goPackageswas replaced with separated Go applications in appropriatenixpkgscategories. Each Go package uses its own dependency set. There’s also a newgo2nixtool introduced to generate a Go package definition from its Go source automatically.services.mongodb.extraConfigconfiguration format was changed to YAML.PHP has been upgraded to 7.0
Other notable improvements:
Revamped grsecurity/PaX support. There is now only a single general-purpose distribution kernel and the configuration interface has been streamlined. Desktop users should be able to set
{ security.grsecurity.enable = true; }to get a reasonably secure system without having to sacrifice too much functionality.
Special filesystems, like
/proc,/runand others, now have the same mount options as recommended by systemd and are unified across different places in NixOS. Mount options are updated duringnixos-rebuild switchif possible. One benefit from this is improved security — most such filesystems are now mounted withnoexec,nodevand/ornosuidoptions.The reverse path filter was interfering with DHCPv4 server operation in the past. An exception for DHCPv4 and a new option to log packets that were dropped due to the reverse path filter was added (
networking.firewall.logReversePathDrops) for easier debugging.Containers configuration within
containers.<name>.configis now properly typed and checked. In particular, partial configurations are merged correctly.The directory container setuid wrapper programs,
/var/setuid-wrappers, is now updated atomically to prevent failures if the switch to a new configuration is interrupted.services.xserver.startGnuPGAgenthas been removed due to GnuPG 2.1.x bump. See how to achieve similar behavior. You might need topkill gpg-agentafter the upgrade to prevent a stale agent being in the way.Declarative users could share the uid due to the bug in the script handling conflict resolution.
Gummi boot has been replaced using systemd-boot.
Hydra package and NixOS module were added for convenience.
Release 16.03 (“Emu”, 2016/03/31)
In addition to numerous new and upgraded packages, this release has the following highlights:
Systemd 229, bringing numerous improvements over 217.
Linux 4.4 (was 3.18).
GCC 5.3 (was 4.9). Note that GCC 5 changes the C++ ABI in an incompatible way; this may cause problems if you try to link objects compiled with different versions of GCC.
Glibc 2.23 (was 2.21).
Binutils 2.26 (was 2.23.1). See #909
Improved support for ensuring bitwise reproducible builds. For example,
stdenvnow sets the environment variableSOURCE_DATE_EPOCHto a deterministic value, and Nix has gained an option to repeat a build a number of times to test determinism. An ongoing project, the goal of exact reproducibility is to allow binaries to be verified independently (e.g., a user might only trust binaries that appear in three independent binary caches).Perl 5.22.
The following new services were added since the last release:
services/monitoring/longview.nixhardware/video/webcam/facetimehd.nixi18n/input-method/default.nixi18n/input-method/fcitx.nixi18n/input-method/ibus.nixi18n/input-method/nabi.nixi18n/input-method/uim.nixprograms/fish.nixsecurity/acme.nixsecurity/audit.nixsecurity/oath.nixservices/hardware/irqbalance.nixservices/mail/dspam.nixservices/mail/opendkim.nixservices/mail/postsrsd.nixservices/mail/rspamd.nixservices/mail/rmilter.nixservices/misc/autofs.nixservices/misc/bepasty.nixservices/misc/calibre-server.nixservices/misc/cfdyndns.nixservices/misc/gammu-smsd.nixservices/misc/mathics.nixservices/misc/matrix-synapse.nixservices/misc/octoprint.nixservices/monitoring/hdaps.nixservices/monitoring/heapster.nixservices/monitoring/longview.nixservices/network-filesystems/netatalk.nixservices/network-filesystems/xtreemfs.nixservices/networking/autossh.nixservices/networking/dnschain.nixservices/networking/gale.nixservices/networking/miniupnpd.nixservices/networking/namecoind.nixservices/networking/ostinato.nixservices/networking/pdnsd.nixservices/networking/shairport-sync.nixservices/networking/supplicant.nixservices/search/kibana.nixservices/security/haka.nixservices/security/physlock.nixservices/web-apps/pump.io.nixservices/x11/hardware/libinput.nixservices/x11/window-managers/windowlab.nixsystem/boot/initrd-network.nixsystem/boot/initrd-ssh.nixsystem/boot/loader/loader.nixsystem/boot/networkd.nixsystem/boot/resolved.nixvirtualisation/lxd.nixvirtualisation/rkt.nix
When upgrading from a previous release, please be aware of the following incompatible changes:
We no longer produce graphical ISO images and VirtualBox images for
i686-linux. A minimal ISO image is still provided.Firefox and similar browsers are now wrapped by default. The package and attribute names are plain
firefoxormidori, etc. Backward-compatibility attributes were set up, but note thatnix-env -uwill not update your currentfirefox-with-plugins; you have to uninstall it and installfirefoxinstead.wmiiSnaphas been replaced withwmii_hg, butservices.xserver.windowManager.wmii.enablehas been updated respectively so this only affects you if you have explicitly installedwmiiSnap.jobsNixOS option has been removed. It served as compatibility layer between Upstart jobs and SystemD services. All services have been rewritten to usesystemd.serviceswmiimenuis removed, as it has been removed by the developers upstream. Usewimenufrom thewmii-hgpackage.Gitit is no longer automatically added to the module list in NixOS and as such there will not be any manual entries for it. You will need to add an import statement to your NixOS configuration in order to use it, e.g.
{ imports = [ <nixpkgs/nixos/modules/services/misc/gitit.nix> ]; }will include the Gitit service configuration options.
nginxdoes not accept flags for enabling and disabling modules anymore. Instead it acceptsmodulesargument, which is a list of modules to be built in. All modules now reside innginxModulesset. Example configuration:nginx.override { modules = [ nginxModules.rtmp nginxModules.dav nginxModules.moreheaders ]; }s3syncis removed, as it hasn’t been developed by upstream for 4 years and only runs with ruby 1.8. For an actively-developer alternative look attarsnapand others.ruby_1_8has been removed as it’s not supported from upstream anymore and probably contains security issues.tidy-html5package is removed. Upstream only provided(lib)tidy5during development, and now they went back to(lib)tidyto work as a drop-in replacement of the original package that has been unmaintained for years. You can (still) use thehtml-tidypackage, which got updated to a stable release from this new upstream.extraDeviceOptionsargument is removed frombumblebeepackage. Instead there are now two separate arguments:extraNvidiaDeviceOptionsandextraNouveauDeviceOptionsfor setting extra X11 options for nvidia and nouveau drivers, respectively.The
Ctrl+Alt+Backspacekey combination no longer kills the X server by default. There’s a new optionservices.xserver.enableCtrlAltBackspaceallowing to enable the combination again.emacsPackagesNgnow contains all packages from the ELPA, MELPA, and MELPA Stable repositories.Data directory for Postfix MTA server is moved from
/var/postfixto/var/lib/postfix. Old configurations are migrated automatically.service.postfixmodule has also received many improvements, such as correct directories’ access rights, newaliasFilesandmapFilesoptions and more.Filesystem options should now be configured as a list of strings, not a comma-separated string. The old style will continue to work, but print a warning, until the 16.09 release. An example of the new style:
{ fileSystems."/example" = { device = "/dev/sdc"; fsType = "btrfs"; options = [ "noatime" "compress=lzo" "space_cache" "autodefrag" ]; }; }CUPS, installed by
services.printingmodule, now has its data directory in/var/lib/cups. Old configurations from/etc/cupsare moved there automatically, but there might be problems. Also configuration optionsservices.printing.cupsdConfandservices.printing.cupsdFilesConfwere removed because they had been allowing one to override configuration variables required for CUPS to work at all on NixOS. For most use cases,services.printing.extraConfand new optionservices.printing.extraFilesConfshould be enough; if you encounter a situation when they are not, please file a bug.There are also Gutenprint improvements; in particular, a new option
services.printing.gutenprintis added to enable automatic updating of Gutenprint PPMs; it’s greatly recommended to enable it instead of addinggutenprintto thedriverslist.services.xserver.vaapiDrivershas been removed. Usehardware.opengl.extraPackages{,32}instead. You can also specify VDPAU drivers there.programs.ibusmoved toi18n.inputMethod.ibus. The optionprograms.ibus.pluginschanged toi18n.inputMethod.ibus.enginesand the option to enable ibus changed fromprograms.ibus.enabletoi18n.inputMethod.enabled.i18n.inputMethod.enabledshould be set to the used input method name,"ibus"for ibus. An example of the new style:{ i18n.inputMethod.enabled = "ibus"; i18n.inputMethod.ibus.engines = with pkgs.ibus-engines; [ anthy mozc ]; }That is equivalent to the old version:
{ programs.ibus.enable = true; programs.ibus.plugins = with pkgs; [ ibus-anthy mozc ]; }services.udev.extraRulesoption now writes rules to99-local.rulesinstead of10-local.rules. This makes all the user rules apply after others, so their results wouldn’t be overridden by anything else.Large parts of the
services.gitlabmodule have been rewritten. There are new configuration options available. ThestateDiroption was renamed tostatePathand thesatellitesDiroption was removed. Please review the currently available options.The option
services.nsd.zones.<name>.datano longer interpret the dollar sign ($) as a shell variable, as such it should not be escaped anymore. Thus the following zone data:$ORIGIN example.com. $TTL 1800 @ IN SOA ns1.vpn.nbp.name. admin.example.com. (Should modified to look like the actual file expected by nsd:
$ORIGIN example.com. $TTL 1800 @ IN SOA ns1.vpn.nbp.name. admin.example.com. (service.syncthing.dataDiroptions now has to point to exact folder where syncthing is writing to. Example configuration should look something like:{ services.syncthing = { enable = true; dataDir = "/home/somebody/.syncthing"; user = "somebody"; }; }networking.firewall.allowPingis now enabled by default. Users are encouraged to configure an appropriate rate limit for their machines using the Kernel interface at/proc/sys/net/ipv4/icmp_ratelimitand/proc/sys/net/ipv6/icmp/ratelimitor using the firewall itself, i.e. by setting the NixOS optionnetworking.firewall.pingLimit.Systems with some broadcom cards used to result into a generated config that is no longer accepted. If you get errors like
error: path ‘/nix/store/*-broadcom-sta-*’ does not exist and cannot be createdyou should either re-run
nixos-generate-configor manually replace"${config.boot.kernelPackages.broadcom_sta}"byconfig.boot.kernelPackages.broadcom_stain your/etc/nixos/hardware-configuration.nix. More discussion is on the github issue.The
services.xserver.startGnuPGAgentoption has been removed. GnuPG 2.1.x changed the way the gpg-agent works, and that new approach no longer requires (or even supports) the “start everything as a child of the agent” scheme we’ve implemented in NixOS for older versions. To configure the gpg-agent for your X session, add the following code to~/.bashrcor some file that’s sourced when your shell is started:GPG_TTY=$(tty) export GPG_TTYIf you want to use gpg-agent for SSH, too, add the following to your session initialization (e.g.
displayManager.sessionCommands)gpg-connect-agent /bye unset SSH_AGENT_PID export SSH_AUTH_SOCK="''${HOME}/.gnupg/S.gpg-agent.ssh"and make sure that
enable-ssh-supportis included in your
~/.gnupg/gpg-agent.conf. You will need to usessh-addto re-add your ssh keys. If gpg’s automatic transformation of the private keys to the new format fails, you will need to re-import your private keyring as well:gpg --import ~/.gnupg/secring.gpgThe
gpg-agent(1)man page has more details about this subject, i.e. in the “EXAMPLES” section.
Other notable improvements:
ejabberdmodule is brought back and now works on NixOS.Input method support was improved. New NixOS modules (fcitx, nabi and uim), fcitx engines (chewing, hangul, m17n, mozc and table-other) and ibus engines (hangul and m17n) have been added.
Release 15.09 (“Dingo”, 2015/09/30)
In addition to numerous new and upgraded packages, this release has the following highlights:
The Haskell packages infrastructure has been re-designed from the ground up (“Haskell NG”). NixOS now distributes the latest version of every single package registered on Hackage – well in excess of 8,000 Haskell packages. Detailed instructions on how to use that infrastructure can be found in the User’s Guide to the Haskell Infrastructure. Users migrating from an earlier release may find helpful information below, in the list of backwards-incompatible changes. Furthermore, we distribute 51(!) additional Haskell package sets that provide every single LTS Haskell release since version 0.0 as well as the most recent Stackage Nightly snapshot. The announcement “Full Stackage Support in Nixpkgs” gives additional details.
Nix has been updated to version 1.10, which among other improvements enables cryptographic signatures on binary caches for improved security.
You can now keep your NixOS system up to date automatically by setting
{ system.autoUpgrade.enable = true; }
This will cause the system to periodically check for updates in your current channel and run nixos-rebuild.
This release is based on Glibc 2.21, GCC 4.9 and Linux 3.18.
GNOME has been upgraded to 3.16.
Xfce has been upgraded to 4.12.
KDE 5 has been upgraded to KDE Frameworks 5.10, Plasma 5.3.2 and Applications 15.04.3. KDE 4 has been updated to kdelibs-4.14.10.
E19 has been upgraded to 0.16.8.15.
The following new services were added since the last release:
services/mail/exim.nixservices/misc/apache-kafka.nixservices/misc/canto-daemon.nixservices/misc/confd.nixservices/misc/devmon.nixservices/misc/gitit.nixservices/misc/ihaskell.nixservices/misc/mbpfan.nixservices/misc/mediatomb.nixservices/misc/mwlib.nixservices/misc/parsoid.nixservices/misc/plex.nixservices/misc/ripple-rest.nixservices/misc/ripple-data-api.nixservices/misc/subsonic.nixservices/misc/sundtek.nixservices/monitoring/cadvisor.nixservices/monitoring/das_watchdog.nixservices/monitoring/grafana.nixservices/monitoring/riemann-tools.nixservices/monitoring/teamviewer.nixservices/network-filesystems/u9fs.nixservices/networking/aiccu.nixservices/networking/asterisk.nixservices/networking/bird.nixservices/networking/charybdis.nixservices/networking/docker-registry-server.nixservices/networking/fan.nixservices/networking/firefox/sync-server.nixservices/networking/gateone.nixservices/networking/heyefi.nixservices/networking/i2p.nixservices/networking/lambdabot.nixservices/networking/mstpd.nixservices/networking/nix-serve.nixservices/networking/nylon.nixservices/networking/racoon.nixservices/networking/skydns.nixservices/networking/shout.nixservices/networking/softether.nixservices/networking/sslh.nixservices/networking/tinc.nixservices/networking/tlsdated.nixservices/networking/tox-bootstrapd.nixservices/networking/tvheadend.nixservices/networking/zerotierone.nixservices/scheduling/marathon.nixservices/security/fprintd.nixservices/security/hologram.nixservices/security/munge.nixservices/system/cloud-init.nixservices/web-servers/shellinabox.nixservices/web-servers/uwsgi.nixservices/x11/unclutter.nixservices/x11/display-managers/sddm.nixsystem/boot/coredump.nixsystem/boot/loader/loader.nixsystem/boot/loader/generic-extlinux-compatiblesystem/boot/networkd.nixsystem/boot/resolved.nixsystem/boot/timesyncd.nixtasks/filesystems/exfat.nixtasks/filesystems/ntfs.nixtasks/filesystems/vboxsf.nixvirtualisation/virtualbox-host.nixvirtualisation/vmware-guest.nixvirtualisation/xen-dom0.nix
When upgrading from a previous release, please be aware of the following incompatible changes:
sshdno longer supports DSA and ECDSA host keys by default. If you have existing systems with such host keys and want to continue to use them, please set
{ system.stateVersion = "14.12"; }
The new option system.stateVersion ensures that certain configuration changes that could break existing systems (such as the sshd host key setting) will maintain compatibility with the specified NixOS release. NixOps sets the state version of existing deployments automatically.
cronis no longer enabled by default, unless you have a non-emptyservices.cron.systemCronJobs. To forcecronto be enabled, setservices.cron.enable = true.Nix now requires binary caches to be cryptographically signed. If you have unsigned binary caches that you want to continue to use, you should set
nix.requireSignedBinaryCaches = false.Steam now doesn’t need root rights to work. Instead of using
*-steam-chrootenv, you should now just runsteam.steamChrootEnvpackage was renamed tosteam, and oldsteampackage – tosteamOriginal.CMPlayer has been renamed to bomi upstream. Package
cmplayerwas accordingly renamed tobomiAtom Shell has been renamed to Electron upstream. Package
atom-shellwas accordingly renamed toelectronElm is not released on Hackage anymore. You should now use
elmPackages.elmwhich contains the latest Elm platform.The CUPS printing service has been updated to version
2.0.2. Furthermore its systemd service has been renamed tocups.service.Local printers are no longer shared or advertised by default. This behavior can be changed by enabling
services.printing.defaultSharedorservices.printing.browsingrespectively.The VirtualBox host and guest options have been named more consistently. They can now found in
virtualisation.virtualbox.host.*instead ofservices.virtualboxHost.*andvirtualisation.virtualbox.guest.*instead ofservices.virtualboxGuest.*.Also, there now is support for the
vboxsffile system using thefileSystemsconfiguration attribute. An example of how this can be used in a configuration:
{
fileSystems."/shiny" = {
device = "myshinysharedfolder";
fsType = "vboxsf";
};
}
“
nix-env -qa” no longer discovers Haskell packages by name. The only packages visible in the global scope areghc,cabal-install, andstack, but all other packages are hidden. The reason for this inconvenience is the sheer size of the Haskell package set. Name-based lookups are expensive, and mostnix-env -qaoperations would become much slower if we’d add the entire Hackage database into the top level attribute set. Instead, the list of Haskell packages can be displayed by running:
nix-env -f "<nixpkgs>" -qaP -A haskellPackages
Executable programs written in Haskell can be installed with:
nix-env -f "<nixpkgs>" -iA haskellPackages.pandoc
Installing Haskell libraries this way, however, is no longer supported. See the next item for more details.
Previous versions of NixOS came with a feature called
ghc-wrapper, a small script that allowed GHC to transparently pick up on libraries installed in the user’s profile. This feature has been deprecated;ghc-wrapperwas removed from the distribution. The proper way to register Haskell libraries with the compiler now is thehaskellPackages.ghcWithPackagesfunction. The User’s Guide to the Haskell Infrastructure provides more information about this subject.All Haskell builds that have been generated with version 1.x of the
cabal2nixutility are now invalid and need to be re-generated with a current version ofcabal2nixto function. The most recent version of this tool can be installed by runningnix-env -i cabal2nix.The
haskellPackagesset in Nixpkgs used to have a function attribute calledextensionthat users could override in their~/.nixpkgs/config.nixfiles to configure additional attributes, etc. That function still exists, but it’s now calledoverrides.The OpenBLAS library has been updated to version
0.2.14. Support for thex86_64-darwinplatform was added. Dynamic architecture detection was enabled; OpenBLAS now selects microarchitecture-optimized routines at runtime, so optimal performance is achieved without the need to rebuild OpenBLAS locally. OpenBLAS has replaced ATLAS in most packages which use an optimized BLAS or LAPACK implementation.The
phpfpmis now using the default PHP version (pkgs.php) instead of PHP 5.4 (pkgs.php54).The
locateservice no longer indexes the Nix store by default, preventing packages with potentially numerous versions from cluttering the output. Indexing the store can be activated by settingservices.locate.includeStore = true.The Nix expression search path (
NIX_PATH) no longer contains/etc/nixos/nixpkgsby default. You can overrideNIX_PATHby settingnix.nixPath.Python 2.6 has been marked as broken (as it no longer receives security updates from upstream).
Any use of module arguments such as
pkgsto access library functions, or to defineimportsattributes will now lead to an infinite loop at the time of the evaluation.In case of an infinite loop, use the
--show-tracecommand line argument and read the line just above the error message.$ nixos-rebuild build --show-trace … while evaluating the module argument `pkgs' in "/etc/nixos/my-module.nix": infinite recursion encounteredAny use of
pkgs.lib, should be replaced bylib, after adding it as argument of the module. The following module{ config, pkgs, ... }: with pkgs.lib; { options = { foo = mkOption { # … }; }; config = mkIf config.foo { # … }; }should be modified to look like:
{ config, pkgs, lib, ... }: with lib; { options = { foo = mkOption { # option declaration }; }; config = mkIf config.foo { # option definition }; }When
pkgsis used to download other projects to import their modules, and only in such cases, it should be replaced by(import <nixpkgs> {}). The following module{ config, pkgs, ... }: let myProject = pkgs.fetchurl { src = url; sha256 = hash; }; in { imports = [ "${myProject}/module.nix" ]; }should be modified to look like:
{ config, pkgs, ... }: let myProject = (import <nixpkgs> { }).fetchurl { src = url; sha256 = hash; }; in { imports = [ "${myProject}/module.nix" ]; }
Other notable improvements:
The nixos and nixpkgs channels were unified, so one can use
nix-env -iA nixos.bashinstead ofnix-env -iA nixos.pkgs.bash. See the commit for details.Users running an SSH server who worry about the quality of their
/etc/ssh/modulifile with respect to the vulnerabilities discovered in the Diffie-Hellman key exchange can now replace OpenSSH’s default version with one they generated themselves using the newservices.openssh.moduliFileoption.A newly packaged TeX Live 2015 is provided in
pkgs.texlive, split into 6500 nix packages. For basic user documentation see the source. Beware of an issue when installing a too large package set. The plan is to deprecate and maybe delete the original TeX packages until the next release.buildEnv.envon all Python interpreters is now available for nix-shell interoperability.
Release 14.12 (“Caterpillar”, 2014/12/30)
In addition to numerous new and upgraded packages, this release has the following highlights:
Systemd has been updated to version 217, which has numerous improvements.
NixOS is now based on Glibc 2.20.
KDE has been updated to 4.14.
The default Linux kernel has been updated to 3.14.
If
users.mutableUsersis enabled (the default), changes made to the declaration of a user or group will be correctly realised when runningnixos-rebuild. For instance, removing a user specification fromconfiguration.nixwill cause the actual user account to be deleted. Ifusers.mutableUsersis disabled, it is no longer necessary to specify UIDs or GIDs; if omitted, they are allocated dynamically.
Following new services were added since the last release:
atftpdbosunbspwmchronoscollectdconsulcpuminer-cryptonightcrashplandnscrypt-proxydocker-registrydockeretcdfail2banfcgiwrapfleetfluxboxgdmgeoclue2gitlabgitolitegnome3.gnome-documentsgnome3.gnome-online-minersgnome3.gvfsgnome3.seahorsehbasei2pdinfluxdbkubernetesliquidsoaplxcmailpilemesosmlmmjmonetdbmopidyneo4jnsdopenntpdopentsdbopenvswitchparallels-guestpeerflixphdpolipoprosodyradicaleredmineriemannscollectorseekssiproxdstrongswantcsdteamspeak3thermaldtorque/mromtorque/serveruhubunifiznczookeeper
When upgrading from a previous release, please be aware of the following incompatible changes:
The default version of Apache httpd is now 2.4. If you use the
extraConfigoption to pass literal Apache configuration text, you may need to update it — see Apache’s documentation for details. If you wish to continue to use httpd 2.2, add the following line to your NixOS configuration:{ services.httpd.package = pkgs.apacheHttpd_2_2; }PHP 5.3 has been removed because it is no longer supported by the PHP project. A migration guide is available.
The host side of a container virtual Ethernet pair is now called
ve-container-namerather thanc-container-name.GNOME 3.10 support has been dropped. The default GNOME version is now 3.12.
VirtualBox has been upgraded to 4.3.20 release. Users may be required to run
rm -rf /tmp/.vbox*. The lineimports = [ <nixpkgs/nixos/modules/programs/virtualbox.nix> ]is no longer necessary, useservices.virtualboxHost.enable = trueinstead.Also, hardening mode is now enabled by default, which means that unless you want to use USB support, you no longer need to be a member of the
vboxusersgroup.Chromium has been updated to 39.0.2171.65.
enablePepperPDFis now enabled by default.chromium*Wrapperpackages no longer exist, because upstream removed NSAPI support.chromium-stablehas been renamed tochromium.Python packaging documentation is now part of nixpkgs manual. To override the python packages available to a custom python you now use
pkgs.pythonFull.buildEnv.overrideinstead ofpkgs.pythonFull.override.boot.resumeDevice = "8:6"is no longer supported. Most users will want to leave it undefined, which takes the swap partitions automatically. There is an evaluation assertion to ensure that the string starts with a slash.The system-wide default timezone for NixOS installations changed from
CETtoUTC. To choose a different timezone for your system, configuretime.timeZoneinconfiguration.nix. A fairly complete list of possible values for that setting is available at https://en.wikipedia.org/wiki/List_of_tz_database_time_zones.GNU screen has been updated to 4.2.1, which breaks the ability to connect to sessions created by older versions of screen.
The Intel GPU driver was updated to the 3.x prerelease version (used by most distributions) and supports DRI3 now.
Release 14.04 (“Baboon”, 2014/04/30)
This is the second stable release branch of NixOS. In addition to numerous new and upgraded packages and modules, this release has the following highlights:
Installation on UEFI systems is now supported. See Installing NixOS for details.
Systemd has been updated to version 212, which has numerous improvements. NixOS now automatically starts systemd user instances when you log in. You can define global user units through the
systemd.unit.*options.NixOS is now based on Glibc 2.19 and GCC 4.8.
The default Linux kernel has been updated to 3.12.
KDE has been updated to 4.12.
GNOME 3.10 experimental support has been added.
Nix has been updated to 1.7 (details).
NixOS now supports fully declarative management of users and groups. If you set
users.mutableUserstofalse, then the contents of/etc/passwdand/etc/groupwill be congruent to your NixOS configuration. For instance, if you remove a user fromusers.extraUsersand runnixos-rebuild, the user account will cease to exist. Also, imperative commands for managing users and groups, such asuseradd, are no longer available. Ifusers.mutableUsersistrue(the default), then behaviour is unchanged from NixOS 13.10.NixOS now has basic container support, meaning you can easily run a NixOS instance as a container in a NixOS host system. These containers are suitable for testing and experimentation but not production use, since they’re not fully isolated from the host. See Container Management for details.
Systemd units provided by packages can now be overridden from the NixOS configuration. For instance, if a package
fooprovides systemd units, you can say:{ systemd.packages = [ pkgs.foo ]; }to enable those units. You can then set or override unit options in the usual way, e.g.
{ systemd.services.foo.wantedBy = [ "multi-user.target" ]; systemd.services.foo.serviceConfig.MemoryLimit = "512M"; }When upgrading from a previous release, please be aware of the following incompatible changes:
Nixpkgs no longer exposes unfree packages by default. If your NixOS configuration requires unfree packages from Nixpkgs, you need to enable support for them explicitly by setting:
{ nixpkgs.config.allowUnfree = true; }Otherwise, you get an error message such as:
error: package ‘nvidia-x11-331.49-3.12.17’ in ‘…/nvidia-x11/default.nix:56’ has an unfree license, refusing to evaluateThe Adobe Flash player is no longer enabled by default in the Firefox and Chromium wrappers. To enable it, you must set:
{ nixpkgs.config.allowUnfree = true; nixpkgs.config.firefox.enableAdobeFlash = true; # for Firefox nixpkgs.config.chromium.enableAdobeFlash = true; # for Chromium }The firewall is now enabled by default. If you don’t want this, you need to disable it explicitly:
{ networking.firewall.enable = false; }The option
boot.loader.grub.memtest86has been renamed toboot.loader.grub.memtest86.enable.The
mysql55service has been merged into themysqlservice, which no longer sets a default for the optionservices.mysql.package.Package variants are now differentiated by suffixing the name, rather than the version. For instance,
sqlite-3.8.4.3-interactiveis now calledsqlite-interactive-3.8.4.3. This ensures thatnix-env -i sqliteis unambiguous, and thatnix-env -uwon’t “upgrade”sqlitetosqlite-interactiveor vice versa. Notably, this change affects the Firefox wrapper (which provides plugins), as it is now calledfirefox-wrapper. So when usingnix-env, you should donix-env -e firefox; nix-env -i firefox-wrapperif you want to keep using the wrapper. This change does not affect declarative package management, since attribute names likepkgs.firefoxWrapperwere already unambiguous.The symlink
/etc/ca-bundle.crtis gone. Programs should instead use the environment variableOPENSSL_X509_CERT_FILE(which points to/etc/ssl/certs/ca-bundle.crt).
Release 13.10 (“Aardvark”, 2013/10/31)
This is the first stable release branch of NixOS.